KGRKJGETMRETU895U-589TY5MIGM5JGB5SDFESFREWTGR54TY
Server : Apache/2.2.17 (Unix) mod_ssl/2.2.17 OpenSSL/0.9.8e-fips-rhel5 DAV/2 PHP/5.2.17
System : Linux localhost 2.6.18-419.el5 #1 SMP Fri Feb 24 22:47:42 UTC 2017 x86_64
User : nobody ( 99)
PHP Version : 5.2.17
Disable Function : NONE
Directory :  /proc/21571/root/var/lib/rpm/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Current File : //proc/21571/root/var/lib/rpm/__db.002
XX8~~keys@  Yk`L@3c4a02c278c41c6a8e43aff1acc5b96d1271b884a9e122a4c6d9ec946393a9a0702297aff41fce515e9e2e7808eb611be8c9fae16a58e61cf00ce52478d64ecf846a40047e6ea9870f812110c88562a9614b65ee94cff3b0c7e5c86218448f0b9b9ecaad6bbc2cb553b77f0ea628ca1300e150137d04e510719cd7f6beeebd15dce7652b9d6ba3c689174bcab88941e75755289c552a8f6560bb9476292f09cffb502b353f3f3c9cbdc84e852b3ff881ff90cd55b7aab95b6afa476d424c4078cc799c8ee1ee2995d4650974e5d4a11948a7be870a44843ad2f54f8680916f27c67914ddac4be732a9fd2d3c7aa6cccd53a4fb4ede74f4e0b8c2ca417c0b329953a97a413c8b5b84c9ce30f3192c5c94b13d86be28171e852bf694026f9976d478dfe3d46f3840cfe200e23612b49852a8c858cb0ed66e5dea6f52feb07ee56f0076cc05cf18cfcd7d948168799a27b9b7a42266a8dd9bd4e19bcdea669d6d8401689132307b74673e938131018ef6e2e9404f25ac02a84db13a6d8de1f7b4b7228edd70907d60047f50fcc1ac2df9e9deb83177bb792d1a6a7a5cfd1357962282b70bbb57c9390fe173ac0cec15e0b8e513da06f2ea9a2ed4ef0b93e8c0aee6a45e3a9ff7487065c5b667edae38119b5707859455963dbcab22ada2f75b87bdd0c90e7117188fdeac60b6d103dcfe5250c981c8434ddf77481313ebed4a57eafe972a177c1753a31ba6f113f5d8fd1a31ba466625e33167c9eea14447974971f7fec960bcb9f0968603a4b395b0d143c9533bb05a17fdb740075fc940926cf50a78ad241c2dc3a5157b12d96b67463686cf68abcff1edf22dc3d0b865edfc0d0651c60c6f20a034f151f9fc234babcca82ba062941fec658c5be2f04042c62da83eda381a823b702f8550ef6fced6bff0b317c8819e60e59c94be52b2a352be88fbace8a7334baadad1f4b1634cce21a20dab3ed8b7b4fcad610c90d35a0fb4ee30e4362ae0e804fa83f82e9f66a8518a3332cd2c213a70f9c9fe45764438c4200eb16a94bc29d24415d67b05c738c158a6c0b4ed826ce80626a81c8d2d0f341bbc49d11fd04717703e1d74bcbfd3cebaad33b8c2a894011aa35d6f2388f147ce7f198da98ebfc6e176021f5987a4a4245f3c25c50aba066b255b0a27dd713f0dc1795c6b90ea55e4890c2ffe1e464e51703fd289f2be69311bfcc1012f51c0dcc73eac792ef7982cf0f7299fa52833e6010b6d0e6aa15dfeab02c3cebff8d5c8e94ee0a41f9929c2a1df25b4095bd701185b79cdcdde4613cbd44b3525a47a372248adab8abaa9260cedc360c8586bb37d145fb85862f7ea62a95e617120aa1d28603b2205af640cd0a58601b8988e4aa26ff523df096c313d987cabbd61bb4d64248852e8e63d5b7434a81b4b2f8389e93772d6cfe853ad171c3480cb3f52370f79e37288b79984734aec819c697ab528fb1a5990ae6a9e40df87061d460bf95fcb2760e7f5163189e045df8efab306c4c84de9ff3fc6e9a431bf6220406930420d582f6db6a37a115659ebfd61db0fca75e71784cc1a3cd6be54f1b8c0d5519bc3523447390ca4c631ca3396955349337ac2ee1ae80166e79c5ae6b6192cf93b8660c0973df43ae121967aa1775466426590e2f3a905e9eef978cee6c74fcda5f75eb906b0a541e112a4cee5366b28ff1a3658eca44c9723d166b1836ac793fd8208169996a0aa2981096da46e437c91366e277a2b5b7482659302f26d016d8133bc1532b6f328baf6b3a6c16833c9d55305e4809dc88a6e0eb9a0f16f6ea33a9213b3b7f06b78285ac00b7f1cfe939c5b352af258ff2c1a3e17a90bf69eb42402e0b38c1b585842f4926b75de46d5bd7388ecdfb332341b0ef697036a351b9cb8722a3e31665d6c315f922dff7bb5830195809dc40a3e36936606f689f3041c644e99adf92ce1039a4497046d2879a95c0dd5a3556b07901e79d6e5e6a368420a089eba4b78a09708f434ba337683daeff7960aa3633de14a8152030dfa99118db62ee138c7c15fa9ea18a11507e5d9d894e9fca182464597e158996830dc823755dacb12334e5e06569627bd2e9e3ff0d0d770411a6497567afa7c5771482983fa4c34388b333ed9479050ed1510f03dc8a6b97814555077ffa3854162a9e85254736ea091335c39177c66f072be752a67362f1bb11a39379cf290be421d3996a0cc0ecbf234b9fe60a6cc4effa7124e8ad2c540d0c34e1e921a797dc0454284e045559ef7f804fd59bf73d350b2783b06596760b6fa945ef92d465018700f2b2784d02b5d24751563da4457cc5e4a52cf684f51847bc0e430f7747245e0d4a2dc8d913c0be689b8d9b73acc48fab83deb90af0385b39da0b2485d90d4d59058514d07448b6d4352c5d4b72456c47422bc062eb299e8e09f181960b6b4f6525ddfb6c2dc55a2f40d4e91c00e27276277dd0900cfce09d32ca95b63c2c4b99654d5604f8d5133fcc85c6714ec2944db73177e67a68bcd3f4b3ba6090769e7b70b0032f4cf1d09f291ed17ebd9d311e959ab8fa4d6c3d7417b62538297a36f113267eeb0488317897ec618252bd449e83f10db82055c1cc6f148eb41be88930b47747a15c1e483bebe9aefd2b50e12f9749ffb6b4373ff2585f84cbf8f8c0573c27d0a935f49457f1f35066ed7c15f348c1fdf97c43ed1cae1224e486edce940f8e3a1cdc26f506985d8a2bbb018467e4bc45f01f8688243df0a8ed83db4afbb5d5668ddab6350c9ad985bcb226c3576013^kx@dR@RQrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrk/-@/-.-0-;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;6;;;<;;I;P;Q;R;S;T;U;V;W;X;Y;Z;[;\;];^;_;`;a;b;c;d;e;f;g;h;i;j;k;l;m;n;o;p;q;J;K;N;;r;s;;;L;M;O;t;u;v;w;;x;y;z;{;|;};~;;;;;;;;;	;;";;!;#;;;;
;;;;;;;;;;;;
;;; ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;$;%;.;-;;;;;; ;!;";#;&;';(;);*;+;,;/;0;1;2;3;4;5;6;:;7;8;9;;;<;=;>;?;@;A;B;C;D;E;F;G;H;;;;;/usr2.6.26-2.1.25.el5_11																																	































































xml2-configlibxml2libxmlDOCBparser.hHTMLparser.hHTMLtree.hSAX.hSAX2.hc14n.hcatalog.hchvalid.hdebugXML.hdict.hencoding.hentities.hglobals.hhash.hlist.hnanoftp.hnanohttp.hparser.hparserInternals.hpattern.hrelaxng.hschemasInternals.hschematron.hthreads.htree.huri.hvalid.hxinclude.hxlink.hxmlIO.hxmlautomata.hxmlerror.hxmlexports.hxmlmemory.hxmlmodule.hxmlreader.hxmlregexp.hxmlsave.hxmlschemas.hxmlschemastypes.hxmlstring.hxmlunicode.hxmlversion.hxmlwriter.hxpath.hxpathIntej@P@on) [479070]- [scsi] lpfc: Update lpfc to version 8.2.0.63 driver release (Rob Evers) [549763]
- [scsi] lpfc: Fix single SCSI buffer not handled on SLI4 (Rob Evers) [549763]
- [scsi] lpfc: Fix Dead FCF not triggering discovery others (Rob Evers) [549763]
- [scsi] lpfc: Fix vport->fc_flag set outside of lock fail (Rob Evers) [549763]
- [scsi] lpfc: Fix processing of failed read fcf record (Rob Evers) [549763]
- [scsi] lpfc: Fix fc header seq_count checks (Rob Evers) [549763]
- [scsi] lpfc: Update to version 8.2.0.62 driver release (Rob Evers) [549763]
- [scsi] lpfc: Fix hbq buff only for sli4 (Rob Evers) [549763]
- [scsi] lpfc: Fix hbq buff adds to receive queue (Rob Evers) [549763]
- [scsi] lpfc: Fix multi-frame sequence response frames (Rob Evers) [549763]
- [scsi] lpfc: Fix adapter reset and off/online stress test (Rob Evers) [549763]
- [scsi] lpfc: Update to version 8.2.0.61 driver release (Rob Evers) [549763]
- [scsi] lpfc: Fix vport register VPI after devloss timeout (Rob Evers) [549763]
- [scsi] lpfc: Fix crash during unload and sli4 abort cmd (Rob Evers) [549763]
- [scsi] lpfc: Blocked all SCSI I/O requests from midlayer (Rob Evers) [549763]
- [scsi] lpfc: Made TigerShark set up and use single FCP EQ (Rob Evers) [549763]
- [scsi] lpfc: Update to 8.2.0.60 driver release (Rob Evers) [549763]
- [scsi] lpfc: Fix vport not logging out when being deleted (Rob Evers) [549763]
- [net] fixup problems with vlans and bonding (Andy Gospodarek) [526976]
- [net] ixgbe: upstream update to include 82599-KR support (Andy Gospodarek) [513707]
- [net] enic: update to upstream version 1.1.0.241a (Andy Gospodarek) [550148]
- [net] be2net: multiple bug fixes (Ivan Vecera) [549460]
- [net] virtio_net: fix tx wakeup race condition (Herbert Xu) [524651]
- [net] add send/receive tracepoints (Neil Horman) [475457]
- [iscsi] fix install panic w/xen iSCSI boot device (Miroslav Rezanina) [512991]
- Revert: [mm] SRAT and NUMA fixes for span and/or is disc (Larry Woodman) [474097]
- [misc] oprofile support for nehalme ep processors (John Villalovos) [498624]
- [scsi] fix duplicate libiscsi symbol and kabi warnings (Jarod Wilson) [515284]
- [edac] amd64_edac: fix access to pci conf space type 1 (Bhavna Sarathy) [479070]
- [misc] do not evaluate WARN_ON condition twice (Hendrik Brueckner) [548653]
- [xen] fix cpu frequency scaling on Intel procs (Christopher Lalancette) [553324]
- [xen] passthrough MSI-X mask bit acceleration V3 (Don Dugger) [537734]
- [xen] change interface of hvm_mmio_access V3 (Don Dugger) [537734]
- [xen] fix msix table fixmap allocation V3 (Don Dugger) [537734]- [kabi] add scsi_dma_{,un}map (Jon Masters) [533489]
- [kabi] add scsi_nl_{send_vendor_msg,{add,remove}_driver} (Jon Masters) [515812]
- [kabi] add do_settimeofday and __user_walk_fd (Jon Masters) [486205]
- [kabi] add pci_domain_nr (Jon Masters) [450121]
- [sound] alsa hda driver update for rhel5.5 (Jaroslav Kysela) [525390]
- Revert: [pci] avoid disabling acpi to use non-core PCI (Mauro Carvalho Chehab) [504330 547898]
- [net] wireless: fix build when using O=objdir (John Linville) [546712]
- [pci] remove msi-x vector allocation limitation (Stefan Assmann) [531266]
- [net] vxge: avoid netpoll<->NAPI race (Michal Schmidt) [453683]
- [scsi] update fcoe for rhel5.5 (Mike Christie) [526259]
- [net] update tg3 driver to version 3.100 (John Feeney) [515312]
- [block] fix rcu accesses in partition statistics code (Jerome Marchand) [493517]
- [pci] enable acs p2p upstream forwarding (Chris Wright) [518305]
- [net] e1000e: support for 82567V-3 and MTU fixes (Andy Gospodarek) [513706]
- [pci] aer hest disable support (Prarit Bhargava) [547762]
- [pci] aer hest firmware first support (Prarit Bhargava) [547762]
- [block] iosched: fix batching fairness (Jeff Moyer) [462472]
- [block] iosched: reset batch for ordered requests (Jeff Moyer) [462472]
- [net] bonding: allow arp_ip_targets on separate vlan from bond device (Andy Gospodarek) [526976]
- [firewire] ohci: handle receive packets with zero data (Jay Fenlason) [547242] {CVE-2009-4138}
- [drm] intelk@D?d		f	4:@ff	f
pffnf
(fffft(%80T9!T:TTFGfHݔfI,fXߔYߘ\߬f]Df^b;defkltfufv4wfxfy<{HfAA
VfghCpam-devel0.99.6.214.el5_11Files needed for developing PAM-aware applications and modules for PAMPAM (Pluggable Authentication Modules) is a system security tool that
allows system administrators to set authentication policy without
having to recompile programs that handle authentication. This package
contains header files and static libraries used for building both
PAM-aware applications and modules for use with PAM.UeCbuilder17.centos.orgCentOS-5CentOSGPL or BSDDevelopment/Librarieshttp://www.us.kernel.org/pub/linux/libs/pam/index.htmllinuxi3860g#t) s%\!"l$T 
G
(
Z4
? 	$]B+Y*=;5{S#VqA!7Z>Q<Lypj		Y)(**A큤A큤A큤Ue
UeUeUeUeUeUeUe
UeUeUeUe'Ue'Ue'Ue/UeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeUeb66e06f9d75dd78e17adc8832a8c2a970c48366dfd2abe20116e1a13ec3f9cd5d6f4f4f48919dbd044abf34b3dd056985654ba2c27c120e6c200db22036e33ed8dc675f13049fb24fe1d621aa2d7fd5c94292d8d3eb2b78da518654b82b23feaff2e1f4c8ce98c6137d7504e1dfeff42ecca0b77c88a97e7c9e8c4f155fa456db56a97b36b67570ed390eed95b9b7803e14c8220ed275ec8aa967d966e8294c66e9e3646ce01f8813868b2d8514c63f0625be8d19bf67f0b035b91b910ef2dabccb097b1ad1338c28e5c0dfd8afd9fc91f09ec3cfe08babb145d475d5d776baefc66f246b5f67182f6a4d3ac52c5d0f9e5c8672dd7bfbfd71e2ab1474d56f657a0a889fe3e408c83c0a19d64ad8044455587ddc86698b784d288784d61ddc5f92b4b1dd5ca92e8e1b5b4b9b113de669d2bcdc228ecc7b1308c5a51a29a005761b672d2872107e50ebea2ce86b2cac0860a4faa8d121d3988261c47043541ee256a385dd198db1b1c28a36adf5dea0b91abeb60f14682f7fdeb701216dea61177bda85eccb348ccf362ebd09270454a55fa3835bbfa76c2d713117eb21dded57556c351f30cbf5881a5b3cc4564c80984df2929abed08b7f8c0666b50e6f5b834180df2b2ff4528e9e2e67710706d040aa02c922ef33aeb32c5d9d7b1df95a14402e8e90a9b3c8b2b6f82b66a3b80d835c58ecb4807235589749aa0f0511e65e4d76f30fc01932df33a1f298c7102fab4f9bf9b31daf5d544d019178ad885e469fe827dcd1cd4a4adc424193e45d85ae6d40ee0186bd8dk*-@*-)-+-019641f266561736fb97f8dc86ebafb8578527baca4c567b5f68fbe453d086432a13c6e957338b742d2a6694caedd9d3844041a38b88c7d0a4e3f2105bb065aa7dc793402ba4407f1c9aae96af59d9c47d3be90e696975176a326a9a7554d336b11a4261dcf187cc291f52ad57f60520d4ddd746715f3648b13a3860d8fb5f11ee78e76703ca1873597964e2a07d5ff0bc57f0fc07c9c0c6eecf95c44f52f08a8866671741018f92f369f77cea92b29d3fb4d6e0a4257f72155f9c9d48a9a3c1ca6f8aa3aad840373c5dff23711824632c8ff618329c3314f7c6dcc137d39cecb1faacf912cec8cf455ab8ae92ca2f6656861aee143305d03f6da139c4682506485bba2c6110233a495854076493d79ff563aed8468d72d13988a90ab467fea450bbc094db57dd84816f2f2909345bd9abf18bfd2514584d7d04328acefde7d0dcd40ba4b57341d9f59e810a3767e34e62c0c903967789e094b5a88e02f611ec9261d67cf0df4641bb11fd4a8c864ee73d09aaab25ba0b7ff041879391952cc7bb90c48926316d9af6e2d70ca7013adeb3d91cf23f7c9199b395356ea98cd0971114959f0b7e0c2afb591ffd670bed28a76f0884019da635ce316fe2c30423936704060ba0272a9624e0a732455439ba29dfd4b3dec5fee179d3dc7e3d65be8a9dbeb80a09ec66c2de0a36d8cb049767097e89ffd4d5a84e0e866f1d0434bcd6acf81262461d53cb6b97826f52fe246c9ca5545821a069bc583560631c1aa4b5c5fc25c1a2715a2cab3b21c2cda2e5015a8ead4a5cc05535b67fc7ddec6848069415b5724994dc223e039169c489e0b3438a1668d854e00dbdfc452c20b46d2437300eb3a25a62ad0cb2369e96629879bc213e435118b0a2441e9da041d103de064496e4ec4f6ec75800259d2386c1255f24238b89a28aee624039121da5b11d195b92cdb7d81107bc0d9b07af623905ec95cab62beb1641d6015b9b1167d6e13bc3fad3dfbb3687b188aa851158a661ef52ad868ba2ca01fe4077b4930bd07558db016d34982bbf47b32d8fcd7b5f48821de9e855568781f8c87ad0fe9afcba0c28d14f1ca20276cc19b7d385a5746182227b22b8ec580a834662f6d7f5d0dfc1063365cedce05c3c75361d8b21eda0117b77298a7a425746107997bb1d9ed7c6a030758261e4b23c18fe8fa9b9f1cb35924de5d0e047f4e2732e8ef4d31fea1533aa6faa9efa078a56d2d37b4e318c745ea8e70138377b1fb1d0e3116dba631ebc80d9df8a1b0568f9cf7a2cc70a3e634d99e8339b4979f979df58edb1ac31c7e547f58d4407d091d189a1ebfeab77f19902d1da636bacfcf940527188d9f5215d0764400d469f7a05cc4423a3babfce152220e5a24918935d6f0c8bbcf587342c99ab6ebaa09c6ec959a5cb80ea012f8c9c74667d1434104e5610a77f824f5ffe018a2890cdd13b4d08d674cf8dd44084cf4871ee86fef27f5e5ee91ea4550ba76ca9c89e995bbaf258ab154e5205648528d58d55d7273c625cb22ba5a0a40a7d0b40ec7473b3bbc976d2f48715f44d4d5f3e8297d35e59d9f92c876b42ac25f46f0d4a00c9be5310e0ccc1a5cebf8e5cc417bcb23115c4f802404e09657e6d10ac1b8fb04bc8fb73f9964589a2231e16356328b8e3fa703a18858a11f3bbb17392db5c3d44715dd9306783b14227cf508aadb27c5c145ac58d256326e8ebd118fd363e46a52231d30d0d20467cffc32344efbb7334a5f2563420e0d1723c44a53d1b4d946cde705740f3b51a801244bfaf988aa333c37e94cfa2be161bf808f5614fefabdb297aa7bdf9ecf2cf5ff6192f4292d744423df690e785d60fdf08f5614fefabdb297aa7bdf9ecf2cf5ff771308152ab24a69682daed70ce136d5d54baebd532e49492c51ea18bcefa720306e8e79755695a68599e2a71dae3f5949bb67f423519384ffbafc54241f20676841f536f4746aecb0cfead183c7dbc0238f2fe37df919478814b0c6b3d50d1b095d69f395e6ba6d04b690b9495c48bc5f3d7c58fe95b1556d028f2b593e5522bea9df2d3b420e380bbbd3265a5a820fd89bac4edcf13e1fc4da4c5ee736f73791c36fc10093b0d85b7da650a2144d748e88ffa7dc60314ae7021d2dcf3956f841baedbe09ed8743f0a1396e1a9d3a2e21e990d3bbdacdc40c8dc29464b0ca46381af50b43f25dc47ef9aa52d4179ea08f5614fefabdb297aa7bdf9ecf2cf5f5d67fcf03d6dff407df639d4c5f257d6fe3ed025c008652d970f88e8fe402f58684b7fdccf7c5f925ab90b55cb4dcac7ae9455c9eeba328ecb51da357e5df2c8355a6b70a27bb9775da5e696b8bd414047b37203592d5c4de6cc5cb2675a66cb3e8bf245b3bff7521422520d1b1445497c40ffec9e50594105f0efa524510529879ab5649954e97831913a4e3f6115132ab2c8c67bf5d1ba65bea44392bcb3e3103d16eb1b587dcd8dfae1925118a5a06106d4eb0e5f57868b527a03ab304f30308529b43c9ccf31a3615d05868df4940cbdad92f6ea1fd9eab8d15a21bfcdfa30533b4c3afe3dc3da2cdba7805c0ed52f53bc3ed6a11b82b636ad112691a349ddb54b648ecf60938e90842d417287d544d3eab4a206545cb6f1219a42f3c1e677b437e759c1a2d69ba8955aec374f21fd4ecf7b770caa231b3dbf7495f185449167eae486472a1bdfc47d31d7d60dc5b3789fe3e673c82b7928214142154ad6a8e85f472e6388992880af3ba030d242ef7c75bed4960f379f9d16e5f923bd32f1d56e79fkx@686201dea18293de3d3f50e90852367db3ec1ca22c4bc3b8d2026da8e09b02fc1472951e9cbcf2b69f9eb8b96bb351f251d89bc3394670081bfa933c3cdf5984284e3c87eb6ab0b22df7522487f34dd9a78003ac296ce3efa19b07017e861b365ff8d41b6f00d17c888997d367dd06eac2a2b9562f1665d252c83b24c4954f69f724fe2ef25674340fd6484c504bcdbf4b31a8e4431dff692f94fcd7c34b9307bc1a90e0aaf723d233f75f73611895f0092767ee3bf9c3cac0092e5f08db1cff18cdb60a547b65a197156122d3b1f06be392c3467800890a6384e9f4093d544d6e00393263717d84f9d69c6f7bae1e82087fb174c1b189d123beeed8a3c9a169641ae213d35d801b2577e41e39273d8f847bf536ea5baed213c77759e64123ce8f359069d4a1289f0ccfaed95eb358813c388a4bcf6ad2fddee67e0a5f7a6313593329ea2d821acde66ab315e33a3342d475d72ae5cf51b002ee0cfaa694e54ea6f1cfc85854139a9de548e596759a9882cd0fa43481cb7f550e96f5cdf992ea69c8ce82a3ab76f44fe640dbf52c5d2064517a4a56a0c702c5e578eed7dedb465b6e0456537bcecd8b29e01ff7f454336ee635701631b547de91e6892f86e91b6baf8e93f23d817e876803901573298ed7354fe8a794b99953c4d79f4168e03e726c18825ea4419741f476781be43840020fe8118b84c86ec64ab4c68c5a5d682a44f56e834543a8df4ab81f7936882ce64bd7e1a06f0de8599deb1f3fa9a4c8447f78b316ef7b26700bb13df2bfd1d901aaa5975101a774dadc2941e07bd44ee0d3e794cfcdb7ef85bc875feaee80c55b0733734050fe69282608f922928be4b5e4493c7c5e985c02d7758180aa0179ab3e7cf3b646e62f1140522f6b512a2f3a0f5e97a50bd294bc1d94299d25a1f615ca9f3f269916dd0e911ddff87c6321e123385bd2ea5f1b62218c43016510db28b5b7ba647965984c0e9cbfe4137f536f56f191a41596c2d1d8d75f2f6a91f87d68c5f38dddec20607ad5a79c37a6e59fb822dfa41317230848746997f0c6785c6046ace8df370e8938656cf46a8c357b67c78b9805ab30a06ab44aaca85ff91288292d89a758167bfc443b3d3b03e6aa83a8f903d36ef8085bb457afed391d230f08d878e79038ca40a439de573ebc2130d97c5f8f8478b58fea26b45a89d4089abf9fc05318e7e8bccecc4dd4466337daf31fcaf2fd8e94b23c90983909f7b6045c7897c49cc4366ababd3db2c9e943c0930b35235484b58fd9a6dc5f512822901a775b767017d8afa7e20587386e8d6079951de0235c7d8b5fddb0bbcbaeeaec57c291abb159e768e9ac590a5ea107a0d84874920b60d0add9d528d9968d6f1cfb108364f3044ae6f78dd6dccf0b150ffbff39aa6af80e698dda6c624d218ceb94483ea9ea8f3706fadee2ed801362279f455c89b73f4d817ec995d67f2a66b46a185d347f86217a4f84bbd006636184e01e260c6e718c6ca9b91f325f0b8d570b3f0609259bca13d7f3cb69e97bad540ca69f503e6f2389dbffaefd79f2852e2f45c6381e6c0fb5d459b542300f09399b258007bfccaa3ce6646a216735b5e139b2162790b3652aab62c5f0d2408d42fd756aea26bc011f30830bf2d8b330b562bd0356e3abeb4c8a11c766edc203363198253be2fa700a28757277982f25c082914082f61e56b756357fa67efb4f4794e2f25e86fd46e27cb427f5a91589c62ff79a8822136af9aecdf771d4f4aa0e9d4e872f15bc50a8b204d504611c49b2d418d96256aaaf2ee1d52d84fd8620809690c84baa31476241a5ad682eda561ed8155cbde12af58898315c9f5da54779f28f1f1351905e70263003eae380c3cdae2ee18667621201e476c3edc79d88f86db2b953029df81a1834f11b88bfee189abc67a4e7c5a51a029fa8613e89e6e523e6274e3bdcde070d09448ab630be01cc1956bf7d18ce42b8694c9cf3960a49023d65b5009cf0c16996e479baef608ef4dc5910097f3dab798db925df9a921cc7da2845d25e6e73490c83aa82ff8f39a3b3725aa8911c80831cadc1f292f1f9265730089ec300a8407e8f1b13528898401cf52f0bfc8ee8740e7e9714d7b7ff0b3b266c9379ec164032dcba4e18461211590239d91a4d79fd485c8a329666d19b1d471ec85adf1007971cb62b33371d9f32deca3e464499f581e00e16927dedb79f8015c4ea164a4904725ff7e573e8489900ea904a1ab14c5bd9db2ac81da4f6d4dfe544b6d80244ebdadd972478cf7df9a50c95cfdfb69f162b76aedda845e7c86ad28aa9b880e0c23c7c7fd0dd0e8545c23567a2e44a1fd6df81383737e428f4a3639ce2469d33f1e987b5b3ce3a47533356ef650edeea9881c410f91621ac8dfb9e710fb4c431dd01d01acbdb911b97a6ea2cc7dd094bc92d12114638d29d97818f6ba9637282c69584fe40347fe30ed7123eb90a8d7a11726da54e7d3eec419e3a6942a70a0275a2ca1d7a957be456b1fbd45895aca30cf2ccbc40b8c99080550ef753cd7c4da0e4096f9a980e8c62057005242be2e6a7442db82d0cc152ac107b6518f8ae68b4a98f41af72db0bfdae58b079d318b846e83932ec607bc66a830de8d468bfb8a9cef54249e0c9b5ae0429221480efee8f42c20c14c68031670c73b18fa4ddbc0e3940cee2aa20689c847495720ae9d2e4c658952568556d07224f44e3373064147414b91cc873d3baba75903252e33c952cd8787e55d934f71f313380bc49f1e3a582c931fe0030dd4j005@564et] tun: add packet accounting (Don Zickus ) [495863]
- [sched] fix cond_resched_softirq() offset (Jesse Larrew ) [496935]
- [ata] sata_sx4: fixup interrupt and exception handling (David Milburn ) [503827]
- Revert: [net] avoid extra wakeups in wait_for_packet (Don Zickus ) [497897]
- [net] e1000: fix skb_over_panic (Neil Horman ) [503441] {CVE-2009-1385}- [x86_64] kvm: export symbols to allow building (john cooper ) [504038]
- [misc] s390 zfcpdump: check for another image on removal (Hans-Joachim Picht ) [499629]
- [net] ixgbe: fix MSI-X allocation on 8+ core systems (Andy Gospodarek ) [500857]
- [s390] dasd: add EMC ioctl to the driver (Christoph Hellwig ) [461288]
- [net] ixgbe: fix polling saturates CPU (Andy Gospodarek ) [503559]
- [misc] core dump: wrong thread info in core dump file (Amerigo Wang ) [503553]
- [crypto] testmgr: check all test vector lengths (Jarod Wilson ) [503091]
- [net] igb and igbvf: return from napi poll correctly (Andy Gospodarek ) [503215]
- [crypto] testmgr: dynamically allocate xbuf and axbuf (Jarod Wilson ) [503091]
- [fs] vfs: skip I_CLEAR state inodes in drop_pagecache_sb (Eric Sandeen ) [500164]
- Revert: [net] tun: add packet accounting (Herbert Xu ) [495863]
- [net] netxen: add GRO Support (Herbert Xu ) [499347]
- [nfs] v4: 'r'/'w' perms for user do not work on client (Peter Staubach ) [502244]
- [x86] nmi: add Intel cpu 0x6f4 to perfctr1 workaround (Prarit Bhargava ) [500892]
- [dm] raid45 target: kernel oops in constructor (Heinz Mauelshagen ) [503070]
- [net] sky2: fix sky2 stats (Neil Horman ) [503080]
- [acpi] check _PSS frequency to prevent cpufreq crash (Prarit Bhargava ) [500311]
- [scsi] mvsas: sync w/ appropriate upstream changes (Rob Evers ) [485126]
- [scsi] mvsas: comment cleanup (Rob Evers ) [485126]
- [scsi] mvsas: correct bit-map implementation (Rob Evers ) [485126]
- [scsi] mvsas: initial patch submission (Rob Evers ) [485126]
- [net] add broadcom cnic driver (mchristi@redhat.com ) [441979]
- [scsi] add bnx2i iscsi driver (mchristi@redhat.com ) [441979]
- [scsi] add netlink msg to iscsi IF to support offload (mchristi@redhat.com ) [441979]
- [misc] add UIO framework from upstream (mchristi@redhat.com ) [441979]
- [net] add cnic support to bnx2 (mchristi@redhat.com ) [441979]
- [powerpc] pass the PDN to check_msix_entries (AMEET M. PARANJAPE ) [502906]
- [fs] proc: avoid info leaks to non-privileged processes (Amerigo Wang ) [499541]
- [net] ixgbe: add GRO suppport (Herbert Xu ) [499347]
- [net] igb: add GRO suppport (Herbert Xu ) [499347]
- [net] cxgb3: add GRO suppport (Herbert Xu ) [499347]
- [net] vlan: add GRO interfaces (Herbert Xu ) [499347]
- [net] tcp6: add GRO support (Herbert Xu ) [499347]
- [net] ipv6: add GRO support (Herbert Xu ) [499347]
- [net] ethtool: add GGRO and SGRO ops (Herbert Xu ) [499347]
- [net] tcp: add GRO support (Herbert Xu ) [499347]
- [net] add skb_gro_receive (Herbert Xu ) [499347]
- [net] ipv4: add GRO infrastructure (Herbert Xu ) [499347]
- [net] add Generic Receive Offload infrastructure (Herbert Xu ) [499347]
- [net] add frag_list support to GSO (Herbert Xu ) [499347]
- [net] add frag_list support to skb_segment (Herbert Xu ) [499347]
- [net] skbuff: add skb_release_head_state (Herbert Xu ) [499347]
- [net] skbuff: merge code copy_skb_header and skb_clone (Herbert Xu ) [499347]
- [netfilter] nf_conntrack: add __nf_copy to copy members (Herbert Xu ) [499347]
- [net] skbuff: add skb_cow_head (Herbert Xu ) [499347]
- [net] netpoll: backport netpoll_rx_on (Herbert Xu ) [499347]
- [net] gro: Optimise Ethernet header comparison (Herbert Xu ) [499347]
- [net] backport csum_replace4/csum_replace2 (Herbert Xu ) [499347]
- [net] backport csum_unfold without sparse annotations (Herbert Xu ) [499347]
- [net] sky2: fix eeprom reads (Neil Horman ) [501050]
- [nfs] v4: client handling of MAY_EXEC in nfs_permission (Peter Staubach ) [500302] {CVE-2009-1630}
- [net] forcedeth: restore power up snippet (Ivan Vecera ) [479740]
- [md] dm: I/O failures when running dm-over-md with xen (Mikulas Patocka ) [223947]
- [selinux] wVk@J>8?:d		3		
"s
vD@6TP(8T9T:'T>?#@+F3GTHPILXYD\]|^]b	d	e	f
k
l
t
$u vw x)y3{8X:::A;=A
;~;;>,g>0h>4Czsh4.2.610.el5_11A powerful interactive shellThe zsh shell is a command interpreter usable as an interactive login
shell and as a shell script command processor.  Zsh resembles the ksh
shell (the Korn shell), but includes many enhancements.  Zsh supports
command line editing, built-in spelling correction, programmable
command completion, shell functions (with autoloading), a history
mechanism, and more.Uobuilder17.centos.org98CentOS-5CentOSBSDSystem Environment/Shellshttp://zsh.sunsite.dk/linuxx86_64if [ ! -f /etc/shells ] ; then
    echo "/bin/zsh" > /etc/shells
else
    grep -q "^/bin/zsh$" /etc/shells || echo "/bin/zsh" >> /etc/shells
fi

/sbin/install-info /usr/share/info/zsh.info.gz /usr/share/info/dir \
	--entry="* zsh: (zsh).			An enhanced bourne shell."if [ "$1" = 0 ] ; then
    /sbin/install-info --delete /usr/share/info/zsh.info.gz /usr/share/info/dir \
	--entry="* zsh: (zsh).			An enhanced bourne shell."
fiif [ "$1" = 0 ] ; then
    if [ -f /etc/shells ] ; then
    	TmpFile=`/bin/mktemp /tmp/.zshrpmXXXXXX`
    	grep -v '^/bin/zsh$' /etc/shells > $TmpFile
    	cp -f $TmpFile /etc/shells
    	rm -f $TmpFile
    	chmod 644 /etc/shells
    fi
fiV0pXϨ$PB ! F2 `5p1h?b !<0"d.?C%Xof"@Tv1E[Y|a#Z7W%ckO~;9+j)G#P
+	j=4tOh3T@9UN>T+	<E^	0
4	yE_	JW2q	S\qv',
o_E
]Z7GuR(G){&!]^RD3T*gjCm_oc&89"	9k?
lW?
{ 2"m-)jGr[h
mc2c6SZc[	L
CL$
-	}G.9`FFd
C P Y-&e1+rX

Z-{O)/@i%Qem^	Raw-	ll
h6(HF>)M	O
{+#	
lh>/kXA.2\M
L
*k;
@share/vim/vim70/lang/sv//usr/share/vim/vim70/lang/sv/LC_MESSAGES//usr/share/vim/vim70/lang/uk//usr/share/vim/vim70/lang/uk/LC_MESSAGES//usr/share/vim/vim70/lang/vi//usr/share/vim/vim70/lang/vi/LC_MESSAGES//usr/share/vim/vim70/lang/zh_CN.UTF-8//usr/share/vim/vim70/lang/zh_CN.UTF-8/LC_MESSAGES//usr/share/vim/vim70/lang/zh_CN//usr/share/vim/vim70/lang/zh_CN/LC_MESSAGES//usr/share/vim/vim70/lang/zh_TW.UTF-8//usr/share/vim/vim70/lang/zh_TW.UTF-8/LC_MESSAGES//usr/share/vim/vim70/lang/zh_TW//usr/share/vim/vim70/lang/zh_TW/LC_MESSAGES//usr/share/vim/vim70/macros//usr/share/vim/vim70/macros/hanoi//usr/share/vim/vim70/macros/life//usr/share/vim/vim70/macros/maze//usr/share/vim/vim70/macros/urm//usr/share/vim/vim70/plugin//usr/share/vim/vim70/print//usr/share/vim/vim70/spell//usr/share/vim/vim70/syntax//usr/share/vim/vim70/tools//usr/share/vim/vim70/tutor/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuwk0	]w	@w	x	v	grub@	@@@JJ/bin/sh/bin/sh/bin/sh/sbin/install-info/usr/bin/cmpmktemprpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)system-logos3.0.4-14.0-14.4.2.3R`P[Pl`PKV+`KV+`JJJ}`G`GE :`E`DCD `DpD`DD`DxD`D`C`C`C"CC`B`B`BT`B`B8`B'B`B`B	6`AL`A`AVA`A\@@e@q`@Lj`@@`@}`@R2@=@-H@+`?;`?`?q?U>H`>]`>/`>(|>p`>=w=u0=s`=<f`<`<e`<d`<4`<Tx`<Q`<L`<3<#;t`;;;`;`;k;i`;WX`;WX`;WX`;WX`;WX`;Sc;R`;F4;B@`;?`;7`;2Václav Pavlín <vpavlin@redhat.com> - 0.97-13.11.1Peter Jones <pjones@redhat.com> - 0.97-13.10Peter Jones <pjones@redhat.com> - 0.97-13.9Peter Jones <pjones@redhat.com> - 0.97-13.8.el5Peter Jones <pjones@redhat.com> - 0.97-13.7Peter Jones <pjones@redhat.com> - 0.97-13.6Peter Jones <pjones@redhat.com> - 0.97-13.5Peter Jones <pjones@redhat.com> - 0.97-13.4Peter Jones <pjones@redhat.com> - 0.97-13.2Peter Jones <pjones@redhat.com> - 0.97-13.1Jesse Keating <jkeating@redhat.com> - 0.97-13Peter Jones <pjones@redhat.com> - 0.97-12Peter Jones <pjones@redhat.com> - 0.97-11Peter Jones <pjones@redhat.com> - 0.97-10Jesse Keating <jkeating@redhat.com> - 0.97-9.1Peter Jones <pjones@redhat.com> - 0.97-9Peter Jones <pjones@redhat.com> - 0.97-8Jesse Keating <jkeating@redhat.com> - 0.97-7Peter Jones <pjones@redhat.com> - 0.97-6Peter Jones <pjones@redhat.com> - 0.97-5Peter Jones <pjones@redhat.com> - 0.97-4Peter Jones <pjones@redhat.com> - 0.97-3Jesse Keating <jkeating@redhat.com> - 0.97-2.1Peter Jones <pjones@redhat.com> - 0.97-2Peter Jones <pjones@redhat.com> - 0.97-1Peter Jones <pjones@redhat.com> - 0.95-17Peter Jones <pjones@redhat.com> - 0.95-16Peter Jones <pjones@redhat.com> 0.95-15Peter Jones <pjones@redhat.com> 0.95-14Peter Jones <pjones@redhat.com> 0.95-13Peter Jones <pjones@redhat.com> 0.95-12Peter Jones <pjones@redhat.com> 0.95-11Peter Jones <pjones@redhat.com> 0.95-10Peter Jones <pjones@redhat.com> 0.95-9Peter Jones <pjones@redhat.com> 0.95-8Peter Jones <pjones@redhat.com> 0.95-7Peter Jones <pjones@redhat.com> 0.95-6Peter Jones <pjones@redhat.com> 0.95-5Jeremy Katz <katzj@redhat.com> 0.95-4Jeremy Katz <katzj@redhat.com> - 0.95-3Jeremy Katz <katzj@redhat.com> - 0.95-2Jeremy Katz <katzj@redhat.com> - 0.95-1Elliot Lee <sopwith@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Warren Togami <wtogami@redhat.com> - 0.94-5Jeremy Katz <katzj@redhat.com> - 0.94-4Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com> 0.94-3Elliot Lee <sopwith@redhat.com> 0.94-2Jeremy Katz <katzj@redhat.com> 0.94-1Jeremy Katz <katzj@redhat.com> 0.93-8Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com> 0.93-7Jeremy Katz <katzj@redhat.com> Jeremy Katz <katzj@redhat.com> 0.93-6Jeremy Katz <katzj@redhat.com> 0.93-5Tim Powers <timp@redhat.com>Jeremy Katz <katzj@redhat.com> 0.93-3Jeremy Katz <katzj@redhat.com> 0.93-2Jeremy Katz <katzj@redhat.com> 0.93-1Jeremy Katz <katzj@redhat.com> 0.92-7Jeremy Katz <katzj@redhat.com> 0.92-6Jeremy Katz <katzj@redhat.com> 0.92-5Tim Powers <timp@redhat.com> 0.92-4Tim Powers <timp@redhat.com> 0.92-3Jeremy Katz <katzj@redhat.com> 0.92-2Jeremy Katz <katzj@redhat.com> 0.92-1Jeremy Katz <katzj@redhat.com> 0.91-4Jeremy Katz <katzj@redhat.com> 0.91-3Jeremy Katz <katzj@redhat.com> Jeremy Katz <katzj@redhat.com> 0.91-2Jeremy Katz <katzj@redhat.com> 0.91-1Jeremy Katz <katzj@redhat.com> 0.91-0.20020102cvsErik Troan <ewt@redhat.com> 0.90-14Jeremy Katz <katzj@redhat.com> 0.90-13Jeremy Katz <katzj@redhat.com> 0.90-12Erik Troan <ewt@redhat.com>Jeremy Katz <katzj@redhat.com> 0.90-11Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@redhat.com>Jeremy Katz <katzj@rkPP@trootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-7.0.109-7.2.el5.src.rpmk`B,@,,,saction (#237478)- Preserve replaced state in transaction (#237478)- Update userlock patch for potential segfault (#231146)- Build without neon (#213055)- Fix ordering issues (#214865)- Flush query buffer patch from jbj (#212833)- Debuginfo extraction with O0- Fix for ordering (#202540, #202542, #202543, #202544)- Various debuginfo fixes (#165434, #165418, #149113, #205339)- Apply matchpathcon patch- Fix debugedit for ppc relocations (#199473)- Fixed null pointer problem in rpmfcELF() DT_GNU_HASH handling- Detect and provide a requirement for DT_GNU_HASH- IPv4/6 and EPSV support by Arkadiusz Miskiewicz <misiek@pld.org.pl>- Force CHANGELOGTIME to be a list in rpm-python- Remove SELinux context verification (#193488)- File classification with autoReq off (#190488)- make rpm-libs requires on base package stronger- put in simple workaround for per-file deps with autoreq off (#190488) 
  while pnasrat works on a real fix- run ldconfig in -libs subpackage %post, not main package
- add patch to generate shared lib deps by following symlinks so that 
  -devel packages sanely depend on main libs- Update --trusted stubs for rpmk breakage- Add --trusted stubs from upstream- Resurrect doxygen (#187714)- remove redundant elfutils-libelf buildrequires
- rpm-python doesn't require elfutils (related to #188495)- Skipdirs on erase again (#187308)
- Make fcntl lock sensitive to --root (#151255)
- Fix netshared path comparison (#52725)
- Fix rpm vercmp (#178798)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Rebuild for newer neon
- Fix scriptlet deadlock (#146549)- Don't emit perl(main) (#177960)- Don't mmap large files- Add mono req/provides support- Remove rpm .la files (#174261)
- Cron job use paths (#174211)- Ignore excluded size (#89661)- Don't skipDirs on erasures (#140055)- Add elfutils Build Requires to rpmbuild (#155129)
- Don't do conflicts if both files %ghost(#155256)
- Fix popt charset for various languages (#172155)
- Don't include .la file (#174261)- rebuilt with new openssl- rebuild for sqlite changes- Actually fix context verification where matchpathcon fails (#162037)- Fix build with CFLAGS having --param
- Fix for context verification in /tmp (#162037)- popt minor version requires- popt minor version bump
- revert to perl.req/perl.prov for now- Upgrade to upstream release- Update translations (#154623)- Drop signature patch
- dangling unpackaged symlinks- Check for symlinks in check-files (#108778)
- Move zh_CN (#154623)
- Test fix for signing old rpms (#127113)- Fix typo
- Fix typo- Add missing fsm.c from matchpathcon patches- Fix typo- Yet more matchpathcon- Some more matchpathcon work- matchpathcon fixup- Use matchpathcon (#151870)- Remove $RPM_BUILD_ROOT and $RPM_BUILD_DIR from distribued .la files (#116891)
- Don't ship static version of _rpmdb.so
- BuildRequires: readline-devel- Fix for (pre,postun) (#155700)
- Erase ordering- add patch to fix segfault with non-merged hdlists- enabled prereqs again- Add devel requires libselinux-devel
- Fileconflicts as FC3 (#151609)- rebuild against renamed sqlite package (#149719).- fix build with new glibc- disable hkp by default- fix build with gcc 4- fix posttrans callback check being backwards (#149524)- don't classify files in /dev (#146623).
- don't build with sqlite3 if <sqlite3.h> is missing.- zlib: uniqify certain symbols to prevent name space pollution.
- macosx: include <sys/types.h> so that python sees the u_char typedef.
- macosx: change to --prefix=/usr rather than /opt/local.
- use waitpid rather than SIGCHLD reaper.
- rip out DB_PRIVATE revert if not NPTL, it's not the right thing to do.- permit build scriptlet interpreters to be individually overridden.- perform callbacks as always (#147537).- fix: length of gpg V4 hash seed was incorrect (#146896).
- add support for V4 rfc-2440 signatures.- add sqlite internal (build still expects external sqlite3-3.0.8).
- sqlite: revert to original narrow scoping of cOpen/cClose.- pythok{0.@0./.1.2.44.4.2.3PU`O^O:`MyILLYLGmH`HEIDpDCC`C`CfCAW;ATAF`@q`@-H@`?>`?6`>k>>[`>YD`>/`=b=y%`=Q`=PF=5= =<f`<z<`;`;`;e;`;X;@;6b::;`:`:R`:h`:`:y`:9`99l`9IQ988`7	`7;K`7`6k6`6y~5R.5H`5!`44K`338JPetr Pisar <ppisar@redhat.com> - 1:3.13-8Petr Pisar <ppisar@redhat.com> - 1:3.13-7Petr Pisar <ppisar@redhat.com> - 1:3.13-6Petr Pisar <ppisar@redhat.com> - 1:3.13-5Petr Pisar <ppisar@redhat.com> - 1:3.13-4Petr Pisar <ppisar@redhat.com> - 1:3.13-3Petr Pisar <ppisar@redhat.com> - 1:3.13-2Ondrej Vasik <ovasik@redhat.com> 1:3.13-1.2.5Ondrej Vasik <ovasik@redhat.com> 1:3.13-1.2.4Steve Dickson <SteveD@RedHat.com> 1:3.13-1.2.3.2Jesse Keating <jkeating@redhat.com> - 1:3.13-1.2.3.1Steve Dickson <steved@redhat.com> - 1:3.13-1.2.3Jesse Keating <jkeating@redhat.com> - 1:3.13-1.2.1Jesse Keating <jkeating@redhat.com> - 1:3.13-1.2Jesse Keating <jkeating@redhat.com>Steve Dickson <steved@redhat.com> 3.13-1Florian La Roche <laroche@redhat.com>Rik van Riel <riel@redhat.com> 3.12-5Steve Dickson <SteveD@RedHat.com>Steve Dickson <SteveD@RedHat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Steve Dickson <SteveD@RedHat.com>Elliot Lee <sopwith@redhat.com> 3.06-11Elliot Lee <sopwith@redhat.com>Steve Dickson <SteveD@RedHat.com>Elliot Lee <sopwith@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Philip Copeland <bryce@redhat.com> 3.06-5Philip Copeland <bryce@redhat.com> 3.06-4Philip Copeland <bryce@redhat.com> 3.06-3Philip Copeland <bryce@redhat.com> 3.06-2Philip Copeland <bryce@redhat.com> 3.06-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com>Guy Streeter <streeter@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Elliot Lee <sopwith@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector <bugzilla@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Jeff Johnson <jbj@redhat.com>Peter Hanecak <hanecak@megaloman.sk>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Fix CVE-2012-3417 (incorrect use of tcp_wrappers) (Resolves: #841448)- Fix parsing numeric arguments of setquota (Resolves: #831520)- Do not use real domains in warnquota example (Resolves: #680429)
- Use /proc/mounts for mountpoint scanning (Resolves: #689822)
- Use rq_bsize to convert quotas transferred by RPC (bug #667360)
- Make RPC block factor dynamic (bug #667360)- Disable grace period/times remote setting (Resolves: #638578)- Fix quotactl(2) manual to refer struct dqblk and dqinfo instead of if_dqblk
  and if_dqblk (Resolves: #656827)- Do not pass ext4 FS to ext2_direct_scan() (Related: #500231)- Enable LDAP support (Resolves: #447780, #459494)
- Enable remote quota support (Resolves: #469753)
- Fix rpc manual chapter inconsistency in rquotad(8) page (Resolves: #474836)
- Add ext4 file system support (Resolves: #500231)
- Add quotaoff(8) symlink to quotaon(8) manual (Resolves: #574804)
- Show grace period even if hard limit has been reached (Resolves: #589472)
- warnquota(8) manual should constrain onjc	PV@VW360]
- [net] bnx2x: Duplication in promisc mode (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: multicasts in NPAR mode (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Update bnx2x version to 1.62.00-5 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix potential link loss in multi-function mode (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix port swap for BCM8073 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix LED blink rate on BCM84823 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Remove setting XAUI low-power for BCM8073 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Update bnx2x version to 1.62.00-4 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix AER setting for BCM57712 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix BCM84823 LED behavior (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Mark full duplex on some external PHYs (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix BCM8073/BCM8727 microcode loading (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: LED fix for BCM8727 over BCM57712 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Common init will be executed only once after POR (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Swap BCM8073 PHY polarity if required (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: fix typos (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix the race on bp->stats_pending. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Move to D0 before clearing MSI/MSI-X configuration. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: registers dump fixes (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Don't prevent RSS configuration in INT#x and MSI interrupt modes. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: adding dcbnl support (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Use static const (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: remove bogus check (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: update version to 1.62.00-2 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: update firmware to 6.2.5.0 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: bnx2x_request_firmware update for 6.2.5.0 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: replace FW to 6.2.5 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Add DCB/PFC support - link layer (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: add DCB support (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Disable FCoE ring, NETDEV_HW_ADDR_T_SAN for RHEL5.7. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: add FCoE ring (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Update version number and a date. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fixed a compilation warning (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Use dma_alloc_coherent() semantics for ILT memory allocation (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: LSO code was broken on BE platforms (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Add Nic partitioning mode (57712 devices) (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Use helpers instead of direct access to the shinfo(skb) fields (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Do interrupt mode initialization and NAPIs adding before register_netdev() (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Disable local BHes to prevent a dead-lock situation (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: fix error value sign (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Remove unnecessary semicolons (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Update version number (Michal Schmidt) [629609 651546 653357 656360]
- [n?kpS3@34
OJJ!JJGJJJJJJJ!JJ+JMJIJ?0:3.0.33-3.41.el5_11mount.cifsumount.cifseventlogadmfindsmbnmblookuprpcclientsmbcaclssmbclientsmbgetsmbprintsmbspoolsmbtarsmbtreecifs.upcallfindsmb.1.gznmblookup.1.gzrpcclient.1.gzsmbcacls.1.gzsmbclient.1.gzsmbget.1.gzsmbtar.1.gzsmbtree.1.gzcifs.upcall.8.gzmount.cifs.8.gzsmbspool.8.gzumount.cifs.8.gz/sbin//usr/bin//usr/sbin//usr/share/man/man1//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuBourne shell script text executableELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippeddirectoryperl script text executable+D[tRRRRRRRRRRRRRRRRRR	R
RRRRRRRRRRRRRRR	R
RRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRR? [@1*J[~HO
?W
GV(*)C'60GVA%+/8'qz@tD2?W
GV(X[)ea?;Jas3<ķ1y}10195877067d30421efba18d9e60ddc301c14b7a\<\<1.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-40.el5Benjamin Marzinksi <bmarzins@redhat.com> 0.4.7-39.el5Benjamin Marzinksi <bmarzins@redhat.com> 0.4.7-38.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-37.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-36.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-35.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-34.el5Benjamin Marzinski <bmarzins@redaht.com> 0.4.7-33.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-32.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-31.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-30.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-29.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-28.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-27.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-26.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-25.el5Mike Snitzer <snitzer@redhat.com> 0.4.7-24.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-23.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-22.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-21.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-20.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-19.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-18.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-17.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-16.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-15.el5Benjamin Marzinski <bmarzins@redhat.com> 0.4.7-14.el5Benjamin Marzinski <bmarzins@rekX@L"?!d	
		;	H	d
&
\ @xk(809x0:0>u@BFGHI4XDYTZt[x\|]^Hbd7e<fAkClHt`uvw!x!Hy!{!!""A"QA
""""g"h"Cnss_db2.238.el5_11An NSS library for the Berkeley DB.Nss_db is a set of C library extensions which allow Berkeley Databases
to be used as a primary source of aliases, ethers, groups, hosts,
networks, protocol, users, RPCs, services, and shadow passwords
(instead of or in addition to using flat files or NIS). Install nss_db
if your flat name service files are too large and lookups are slow.Tcbuilder17.centos.org(CentOS-5CentOSGPLSystem Environment/Librarieshttp://sources.redhat.com/glibc/linuxi386(sFHboWA큤TcTcTcTcTc9Ht67R9P":G:Gw9HTn?Tc481b4be0ddc7f35fb62ee32350472f918142ff288d9d5dc7e3b557126a7485c2703d61176777de5f07411a77db42a8b694d55d512a9ba36caa9b7df079bae19ff30a9716ef3762e3467a2f62bf790f0ad2328298f90d8cb50742e02d181fed8c408fd2b1b6aa6e40c4a4a8d3fbef74f17426c2bdd61db6be11a46d885ada9fa44ce7c5f14a27526b45ac86206a8e43ec6626f3a000238d854b269279a3bdae61c068892cbdc386d000607a3013c706c4libnss_db-2.2.so../../lib/libnss_db.so.2rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnss_db-2.2-38.el5_11.src.rpmconfig(nss_db)libnss_db.so.2libnss_db.so.2(GLIBC_2.0)nss_db@@@@@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfig/sbin/ldconfigconfig(nss_db)glibclibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libnss_db.so.2libnss_files.so.2libselinux.so.1makerpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)2.2-38.el5_112.3.3-523.0.4-14.0-1glibc2.24.4.2.3Tnd`TgKQG_`G0DpCG`CC`C`C;`CBnBIB8`B#`AvA	s`@ @q`@E@-H?`?`?9c`>k>k>/`>$`==<Z<}`<M`<M`<{`<)<<v`<qy`<O2`;o`;;
`:#`:`:?`9J`Nalin Dahyabhai <nalin@redhat.com> - 2.2-38Nalin Dahyabhai <nalin@redhat.com> - 2.2-37Nalin Dahyabhai <nalin@redhat.com> - 2.2-36Nalin Dahyabhai <nalin@redhat.com> - 2.2-35.3Nalin Dahyabhai <nalin@redhat.com> - 2.2-35.2Jesse Keating <jkeating@redhat.com> - 2.2-35.1Nalin Dahyabhai <nalin@redhat.com> - 2.2-35Jesse Keating <jkeating@redhat.com> - 2.2-34.2.1Jesse Keating <jkeating@redhat.com> - 2.2-34.2Jesse Keating <jkeating@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2-34Nalin Dahyabhai <nalin@redhat.com> 2.2-33Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2-32Nalin Dahyabhai <nalin@redhat.com> 2.2-31Nalin Dahyabhai <nalin@redha'k@mserbian.vimserbian_cp1250.vimserbian_cp1251.vimserbian_iso-8859-2.vimserbian_iso-8859-5.vimserbian_utf-8.vimsinhala-phonetic_utf-8.vimsinhala.vimslovak.vimslovak_cp1250.vimslovak_iso-8859-2.vimslovak_utf-8.vimtamil_tscii.vimthaana-phonetic_utf-8.vimthaana.vimukrainian-jcuken.vimvietnamese-viqr_utf-8.vimlangREADME.txtafLC_MESSAGESvim.mocaLC_MESSAGESvim.mocsLC_MESSAGESvim.modeLC_MESSAGESvim.moen_GBLC_MESSAGESvim.moesLC_MESSAGESvim.mofrLC_MESSAGESvim.mogaLC_MESSAGESvim.moitLC_MESSAGESvim.mojaLC_MESSAGESvim.mokoLC_MESSAGESvim.momenu_af.latin1.vimmenu_af.utf-8.vimmenu_af_af.latin1.vimmenu_af_af.utf-8.vimmenu_ca.latin1.vimmenu_ca.utf-8.vimmenu_ca_es.latin1.vimmenu_ca_es.utf-8.vimmenu_chinese(gb)_gb.936.vimmenu_chinese(taiwan)_taiwan.950.vimmenu_chinese_gb.936.vimmenu_chinese_taiwan.950.vimmenu_cs.cp1250.vimmenu_cs.latin1.vimmenu_cs_cz.cp1250.vimmenu_cs_cz.iso_8859-2.vimmenu_cs_cz.latin1.vimmenu_czech_czech_republic.1250.vimmenu_czech_czech_republic.1252.vimmenu_czech_czech_republic.ascii.vimmenu_de.latin1.vimmenu_de.utf-8.vimmenu_de_de.latin1.vimmenu_de_de.utf-8.vimmenu_en_gb.latin1.vimmenu_en_gb.utf-8.vimmenu_english_united_kingdom.1252.vimmenu_english_united_kingdom.ascii.vimmenu_es.latin1.vimmenu_es.utf-8.vimmenu_es_es.latin1.vimmenu_es_es.utf-8.vimmenu_fr.latin1.vimmenu_fr.utf-8.vimmenu_fr_fr.latin1.vimmenu_fr_fr.utf-8.vimmenu_french_france.1252.vimmenu_german_germany.1252.vimmenu_hu.iso_8859-2.vimmenu_hu.utf-8.vimmenu_hu_hu.iso_8859-2.vimmenu_hu_hu.utf-8.vimmenu_it.latin1.vimmenu_it.utf-8.vimmenu_it_it.latin1.vimmenu_it_it.utf-8.vimmenu_italian_italy.1252.vimmenu_ja.cp932.vimmenu_ja.euc-jp.vimmenu_ja.eucjp.vimmenu_ja.ujis.vimmenu_ja.utf-8.vimmenu_ja_jp.cp932.vimmenu_ja_jp.euc-jp.vimmenu_ja_jp.eucjp.vimmenu_ja_jp.ujis.vimmenu_ja_jp.utf-8.vimmenu_japanese_japan.932.vimmenu_ko.utf-8.vimmenu_ko_kr.euckr.vimmenu_ko_kr.utf-8.vimmenu_ko_kr.vimmenu_nl.latin1.vimmenu_nl.utf-8.vimmenu_nl_nl.latin1.vimmenu_nl_nl.utf-8.vimmenu_no.latin1.vimmenu_no.utf-8.vimmenu_no_no.latin1.vimmenu_no_no.utf-8.vimmenu_pl.cp1250.vimmenu_pl_pl.cp1250.vimmenu_pl_pl.iso_8859-2.vimmenu_pl_pl.utf-8.vimmenu_polish_poland.1250.vimmenu_pt_br.latin1.vimmenu_pt_br.utf-8.vimmenu_pt_br.vimmenu_pt_pt.latin1.vimmenu_pt_pt.utf-8.vimmenu_pt_pt.vimmenu_ru.utf-8.vimmenu_ru_ru.koi8-r.vimmenu_ru_ru.utf-8.vimmenu_ru_ru.vimmenu_sk.cp1250.vimmenu_sk_sk.1250.vimmenu_sk_sk.cp1250.vimmenu_sk_sk.iso_8859-2.vimmenu_sk_sk.vimmenu_sl_si.cp1250.vimmenu_sl_si.latin2.vimmenu_sl_si.utf-8.vimmenu_slovak_slovak_republic.1250.vimmenu_spanish_spain.850.vimmenu_sr.utf-8.vimmenu_sr_yu.ascii.vimmenu_sr_yu.iso_8859-2.vimmenu_sr_yu.iso_8859-5.vimmenu_sr_yu.utf-8.vimmenu_sv.latin1.vimmenu_sv.utf-8.vimmenu_sv_se.latin1.vimmenu_sv_se.utf-8.vimmenu_uk_ua.cp1251.vimmenu_uk_ua.koi8-u.vimmenu_vi_vn.vimmenu_zh.big5.vimmenu_zh.cp936.vimmenu_zh.cp950.vimmenu_zh.gb2312.vimmenu_zh_cn.18030.vimmenu_zh_cn.cp936.vimmenu_zh_cn.gb2312.vimmenu_zh_cn.gbk.vimmenu_zh_cn.utf-8.vimmenu_zh_tw.big5.vimmenu_zh_tw.cp950.vimmenu_zh_tw.utf-8.vimnoLC_MESSAGESvim.moplLC_MESSAGESvim.moruLC_MESSAGESvim.moskLC_MESSAGESvim.mosvLC_MESSAGESvim.moukLC_MESSAGESvim.moviLC_MESSAGESvim.mozh_CNzh_CN.UTF-8LC_MESSAGESvim.moLC_MESSAGESvim.mozh_TWzh_TW.UTF-8LC_MESSAGESvim.moLC_MESSAGESvim.momacrosREADME.txtdvorakeditexisting.vimhanoiclick.mehanoi.vimposterjustify.vimless.shless.vimlifeclick.melife.vimmatchit.txtmatchit.vimmazeMakefileREADME.txtmain.aapmaze.cmaze_5.78maze_macmazeansi.cmazeclean.cpostershellmenu.vimswapmous.vimurmREADME.txtexamplesurmurm.vimmenu.vimmswin.vimoptwin.vimpluginREADME.txtgetscript.vimgzip.vimmatchparen.vimnetrwPlugin.vimrrhelper.vimspellfile.vimtarPlugin.vimtohtml.vimvimballPlugin.vimzipPlugin.vimprintascii.pscidfont.pscns_roman.pscp1250.pscp1251.pscp1252.pscp1253.pscp1254.pscp1255.pscp1257.psdec-mcs.psebcdic-uk.psgb_roman.psl`

0@00Ktx?sd		L	 &-H(zz	z
z	zz
zzbzz!!S# S*gS(*8*r9,r:@fr=O{>O?O@OFOGOzHQzISzXTYT\Tz]Vz^[_bgdhRehWfh\kh^lhethzujhzvlP
wmzxozyq={rzs,s0s@AsA
sssztlgtphttCyelp2.16.030.el5_9A system documentation reader from the Gnome projectYelp is the Gnome 2 help/documentation browser. It is designed
to help you browse all the documentation on your system in
one central tool.Q$+builder10.centos.org V	CentOS-5CentOSGPLApplications/Systemlinuxx86_64if [ "$1" -gt 1 ]; then
  export GCONF_CONFIG_SOURCE=`gconftool-2 --get-default-source`
  gconftool-2 --makefile-uninstall-rule /etc/gconf/schemas/yelp.schemas >& /dev/null || :
fiexport GCONF_CONFIG_SOURCE=`gconftool-2 --get-default-source`
gconftool-2 --makefile-install-rule /etc/gconf/schemas/yelp.schemas >& /dev/null || :
update-desktop-database >& /dev/null ||:

# update icon themes
touch /usr/share/icons/hicolor
if [ -x /usr/bin/gtk-update-icon-cache ]; then
  /usr/bin/gtk-update-icon-cache --quiet /usr/share/icons/hicolor
fiif [ "$1" -eq 0 ]; then
  export GCONF_CONFIG_SOURCE=`gconftool-2 --get-default-source`
  gconftool-2 --makefile-uninstall-rule /etc/gconf/schemas/yelp.schemas >& /dev/null || :
fiupdate-desktop-database &> /dev/null ||:bj	W!f
hm_pq4	KI9
8MU:]7,JHHTGO<:i:gO	KFs:TTJ.u8TI-J&[\1P>~B"II8
jtdk8K	Q:\0:Z	H`Gti8;2ZNM>/DxEF
1	A
 	NER_+9A1"(
.=!e큤AAA큤A큤A큤A큤A큤Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+Q$+33d2783f16a358ddaddff8945939d34ba6d647583f79f6ab82aa31576d5137cb677a8565be363e0ebade4684a2203b55ac4e045a51ceb220e2cf8f47bc5d5f10ae6c30738d39d7f77b781d3d60d5da9179717e62c9ea98fd63ca0733d9c78271af8a68be842207d32afb291a41c09267a912308563aabfc00dca421dd72fc5d45507ca68fb48e029e7435666f735b400baaea6e198d7f552ce374aab92b6f29ek@P@Gnd Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Preston Brown <pbrown@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Preston Brown <pbrown@redhat.com>Jeff Johnson <jbj@redhat.com>- Modified to remove Red Hat branding from the Summaries and Descritpions
  using patch specspo-13-1.el5.centos.patch- Fixed Deployment_Guide-bn-IN summary
  Related: rhbz#520378- Fixed dist tag
  Related: rhbz#835096- Removed word Fedora
  Resolves: rhbz#835096
- Removed word beta
  Resolves: rhbz#520378
- Updated libvirt summary/description
  Resolves: rhbz#698881
- Removed flash-plugin
  Resolves: rhbz#636195- Updated translations
- Resolves: #217856- New version of catalogues
- New translations
- Catalogue generator is now configurable- New version of catalogues- Added missing BR of gettext- update- Update translations- Update translations- bump- group spec and distribution list corrections- Bump- Bump- Bump- Bump- Update translations- Add new locales (#72106)- Update- Update - most po files are now UTF-8- Update- Update- Update- Update- Update- Update- Update translations- Update translations- Update translations- Update translations- Update translations, add jfsutils- Update translations- Update translations- Update translations- Updated translations- Various fixes, corrections from docs- Rebuild- bump- Rebuild- Updated translations- Updated translations- Updated translations- Updated translations- Updated translations
- Include Danish- updated translations- updated translations- Updated translations- s/X11R6-contrib/XFree86-tools/ (#51330)- add cyrus-sasl-md5- refresh-po- new drop, new refresh-po- Updated translations- rebuild, safe iconv- add some missing applications- add some missing applications- 7.1.93- update from CVS
- exclude powertools- Add some IA64-specific packages (#40710)- Add more languages- Updated translations- Updated translations- Fixes to the Spanish translation (#30289)- add msgid strings for openssl095a- fix some redundancies in the Spanish po file- Added ddskk and ddskk-el
- Added tux and kdebindings-*- merged translations for European languages.- updated from CVS- updated ja- updated de es it fr, updated C.po to current package set
- ran make update-po- build for 7.1 Public Beta
- langify everything- build for 7.1builder10.centos.org 1344888950ԒԑԑԑԑԑԑԑԑԒԒԒԒԒԒ#Ԓ)Ԓ/Ԓ5Ԓ;Ԓ@ԒCԒFԒIԒLԒOԒRԒUԒXԒ[Ԓ^ԒaԒdԒgԒjԒmԒpԒsԒvԒyԒ|ԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒarbgbnbncacsdadeelenesetfafifrglguhihrhuhyidiloisitjakaknkokulomkmlmrmsmynbnlnnnopaplptptrorusiskslsqsrsr@Latnsvtatetrukurzhzh13-4.el5.centos13-4.el5.centos	

 !"#$%&'()*+,-./0123456789:;<macros.specsporedhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhatbkX@hanges- rebuilt again- rebuilt- New upstream version
- Fix Doc html includes; looks like texinfo changed incompatibly- Rebuild for GCC4- Install config files using install instead of cp, with mode 644- New upstream version 4.2.1
- FEATURES, MACHINES, and NEWS moved to toplevel dir
- Update zsh-4.0.6-make-test-fail.patch, but do not apply it for now
- Remove upstreamed zsh-4.2.0-jobtable-125452.patch- source profile in zprofile rather than .zshrc (Péter Kelemen,
  Magnus Gustavsson, 102187,126539)
- add zsh-4.2.0-jobtable-125452.patch to fix job table bug
  (Henrique Martins, 125452)
- buildrequire tetex for texi2html (Maxim Dzumanenko, 124182)- rebuilt- update to 4.2.0 stable release
- zsh-4.0.7-bckgrnd-bld-102042.patch no longer needed
- add compinit and various commented config improvements to .zshrc
  (Eric Hattemer,#114887)
- include zshprompt.pl in doc dir (Eric Hattemer)
- drop setenv function from zshrc- rebuilt- rebuilt- update to 4.0.9 release
- zsh-4.0.7-completion-_files-110852.patch no longer needed
- update zsh-4.0.7-bckgrnd-bld-102042.patch to better one with --with-tcsetpgrp
  configure option by Philippe Troin
- configure --with-tcsetpgrp
- buildrequire texinfo for makeinfo
- fix ownership of html manual (Florian La Roche, #112749)- no longer "stty erase" in /etc/zshrc for screen [Lon Hohberger]- quote % in file glob'ing completion code (#110852)
  [reported with patch by Keith T. Garner]
- add zsh-4.0.7-bckgrnd-bld-102042.patch from Philippe Troin to allow
  configure to run in the background (#102042) [reported by Michael Redinger]
- above patch requires autoconf to be run
- include html manual in separate -html subpackage
- changed url to master site
- skip completion tests on ppc and ppc64 for now, since they hang- update to 4.0.7 bugfix release- rebuilt- don't set stty erase in a dumb terminal with tput kbs in /etc/zshrc (#89856)
  [reported by Ben Liblit]
- make default prompt more informative, like bash- skip completion tests on s390 and s390x since they hang- rebuilt- fix adding zsh to /etc/shells- make sure /bin/zsh is owned by root and not bhcompile
- do not package zsh-4.2.6 into binary rpm- define _bindir to be /bin and use it
- use _sysconfdir and _libdir- 4.0.6
- add url
- add --without check build option
- don't autoconf
- make "make test" failure not go ignored
- move sourcing of profile from zshenv to new .zshrc file for now (#65509)
- preserve dates when installing rc files- setup backspace better with tput in zshrc to please screen (#77833)
- encode spec file in utf-8- Make it work with a serial port (#56353)
- Add $HOME/bin to path for login shells (#67110)- automated rebuild- automated rebuild- Source /etc/profile from /etc/zshenv instead of /etc/zprofile, 
  to run things the same way bash do (#62788)- Explicitly specify blank LDFLAGS to avoid autoconf thinking it 
  should strip when linking- Rebuild- automated rebuild- 4.0.4
- Don't force emacs keybindings, they're the default (#55102)- 4.0.3- Fix typo in comment in zshrc (#50214)
- Don't set environment variables in  /etc/zshrc (#50308)- 4.0.2
- Run the testsuite during build- Add libtermcap-devel and libcap-devel to buildrequires- 4.0.1- 4.0.1pre4
- zsh is now available in bz2 - use it- 4.0.1pre3
- remove the dir file from the info directory- Remove contents from /etc/zshenv file - no reason to duplicate things
  from /etc/profile, which is sourced from /etc/zprofile (#32478)- 4.0.1pre2
- remove some obsolete code in /etc/zprofile- noreplace config files.- Handle RLIMIT_LOCKS in 2.4 (#27834 - patch from H.J. Lu)- rebuild to fix #23568  (empty signal list)- fix the post script, so we only have only line for zsh
  and can remove the trigger
- get rid of some instances of "/usr/local/bin/zsh"- fix ia64 build- automatic rebuild- rebuild- 3.0.8
- use %configure and %makeinstall
- updated URL
- disable old patches
- add better patch for texi source
- use %{_mandir} and %{_infodir}
- use %{_tmppath}- patched to recognize export in .zshrc (bug #11169)- rebuild k
+@+++710595c6bc8d79ebea15ff0815df8e3660645064654fabf49e2e45fbf15d06aa7fd7def2bf1560a5002fce56b49761b7f25802b7339de388cd0cc268bf7af252ade03fced1b501a317389c169d102d03c9e785b3f9cb15ae179951ed431e0534c15a404e62fbf4806ad7ce4d9386374553616f79d95ffbc34c53ef22b4c4c7232bbd195f85ca38ab3379c696af5c139d90169302ef37c3f7d864c307a661bb917a37b3ea8821b29ca31a3a6f79d6b095d4fe860288d3986e13332b084a3286d6cfc2bd5f35a1c89e3d1942c58baaeb5762e7b0faec95d198b01317ca335e4c45ff0d0df13176e1849317d82d416a3de57d7e12072065d02af54657cbf96eb5055e43b80612e6742dea69700ecc29b5e8fa39211fbbcd46c3057637c4c7c0d24b51d71250c17c3960443c2d5cddff84082a8120fc925907ff5c6c77884b264f29962ec8bedbd8a60e482c1c42c91306e8f34e2979aad2863fd5b569f86da57ccfe7650a334810a692d839a67ab4d85697f06d65405e6c6b036dc963a13486f40ad76889ce1f03d26cee345e98f86f32931c9ec8c16cd7f1263d7d6dffd10d88f84cd20aec0839cace15168c93ce4c88c75f72bf1189563126368ba00878d5ebca8f3d18fe4cee0dcefd1942c58baaeb5762e7b0faec95d198b74451e3ecf27ee6a8a879a917b4108b89beb152366c9d1463b1f3c589785306bd1942c58baaeb5762e7b0faec95d198ba1668be13adb1ec7bddf4456aadab7c81a57c04ffb739fc74636b00f00f5072dcc0f3dde48eaf314147da96beaa54498e331bbe4f83ccff649f2aac802103cfbd31858ee1d9d3a58afd6a2d9390ded5a2e9d0ae13b6c4f1a6fc054bf7b1b6af5d1942c58baaeb5762e7b0faec95d198bfb5c39c4d28886cbcca1f15f1595f3880a75d5d2b541ef824b1a33f3a4b21630b1b81ece8698428fd6ad3f33bf6cd54dc2c64e350f1b34e05c21158597f26df313df2b6ec9937a53f57a21995cfc971440104364c6c29bae7073673c673010dee0fee8c643b74faed7087b6ebde2682bff225f3bea0a240902691836a0fe02ab940fd84a91a833b8be756b2edfdb16e94af2fa5656e38cc01a8373180dc6956cecb103d0eaa3a39854ae02632cef7d15f8f0dcfcffadd8738c3976afb8583fe351fec7fc14579c8efaa473ca93ce6073663e1b1089ab016977d1527e50ed7d689c45d454b7fa589f23ba4dec108db5b1584a1951665f0da3eac0e9bf77a62f6alibuser.so.1.1.6rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibuser-0.54.7-3.el5.src.rpmconfig(libuser)libuser.so.1()(64bit)libuser_files.so()(64bit)libuser_ldap.so()(64bit)libuser_shadow.so()(64bit)libusermodule.so()(64bit)libuser@@@@@@@@@@@@@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfigconfig(libuser)libc.sj;
hq@ernel update.
  * linux-2.6 changeset: 33525:dcc321d1340a
  * linux-2.6-xen-fedora changeset: 35247:400b0cf28ee4
  * linux-2.6-xen changeset: 22813:80c2ccf5c330
  * xen-unstable changeset: 11069:0340e579f06544431e915d17596ac144145a077e
- xen big config update.  Every config option is the same than normal kernel
  except MICROCODE, TCG_TPM & CONFIG_DEBUG_SLAB.
- disable XEN_FRAMEBUFFER & XEN_KEYBOARD.
- make sysrq c to "crash" all kernels.- NFS 64-bit inode support
- QLogic firmware
- SELinux support for range transitions
- EHEA ethernet driver
- ppc irq mapping fix- New utrace patch:
  - Fix s390 single-step for real this time.
  - Revamp how arch code defines ptrace compatibility.- Update to latest GregKH tree.
- Reenable debug.- cleanup config-rhel-generic to compile again
- removed useless options in config-rhel-generic- ppc64 spec cleanups- Update to squashfs 3.1 which should fix stack overflows seen
  during installation.
- Merge framebuffer driver for OLPC.- enable ia64 xen again.
- xen kernel-update linux-2.6-xen-fedora cset 35236:70890e6e4a72.
  * fix ia64 compilation problems.- disable ia64 xen, it doesn't compile.
- xen HV update cset 11057:4ee64035c0a3
  (newer than that don't compile on ia64).
- update linux-2.6-xen patch to fix sort_regions on ia64.
- fix %setup for xen HV to work at xen HV upgrades.- xen HV update cset 11061:80f364a5662f.
- xen kernel update
  * linux-2.6-xen-fedora cset
  * linux-2.6-xen cset 22809:d4b3aba8876df169ffd9fac1d17bd88d87eb67c5.
  * xen-unstable 11060:323eb29083e6d596800875cafe6f843b5627d77b
  * Integrate xen virtual frame buffer patch.
  * Enable CONFIG_CRASH on xen.- Yet more lockdep fixes.
- Update to GregKH's daily tree.
- GFS2/DLM locking bugfix- New utrace patch: fix ptrace synchronization issues.- GFS2/DLM update.
- Daily GregKH updates
- More lockdep fixes.- Fix utrace_regset nits breaking s390.- Another lockdep fix for networking.
- Change some hotplug PCI options.
- Daily update from GregKH's git tree.
- Unbreak SMP locking in oprofile.
- Fix hotplug CPU locking in workqueue creation.
- K8 EDAC support.
- IPsec labelling enhancements for MLS
- Netlabel: CIPSO labeled networking- Fix utrace/ptrace interactions with SELinux.- Pull post-rc4 fixes from GregKH's git tree.- 2.6.18rc4- 2.6.18rc3-git7- 2.6.18rc3-git6
- Return of signed modules.- New utrace patch:
  - fix s390 single-step
  - first third of ia64 support, enable CONFIG_UTRACE (no ptrace yet)- Update linux-2.6-xen patch.
  * linux-2.6-xen-fedora cset 34931:a3fda906fb82
  * linux-2.6-xen cset 22777:158b51d317b76ebc94d61c25ad6a01d121dff750
  * xen-unstable cset  10866:4833dc75ce4d08e2adc4c5866b945c930a96f225- xen hv compiled with -O2 through Config.mk
- Update xen HV cset 10294.- 2.6.18rc3-git3
- Fix PCI ID clash between ipr and dac960- Copy .config to include/config/auto.conf to avoid unnecessary "make prepare".
- This should finally fix #197220.
- Pulled in patch-2.6.18-rc3-git2.bz2.sign to fix SRPM build failure.- 2.6.18rc3-git2
- Readd patch to allow 460800 baud on 16C950 UARTs.
- Fix backtracing for interrupt stacks- add necessary ia64 hv fixes (#201040)- More GFS2 bugfixing.- s390 kprobes support.
- Fix oops in libata ata_device_add()
- Yet more fixes for lockdep triggered bugs.
- Merge numerous patches from -mm to improve software suspend.
- Fix incorrect section usage in MCE code that blew up on resume.- fix bogus BUG_ON in ptrace_do_wait- 2.6.18rc3-git1- disable CONFIG_DEBUG_SLAB for xen (should fix #200127).- New utrace patch:
  - fix ptrace_do_wait deadlock (#200822, #200605)
  - arch cleanups- disable blktap for xen-ia64 (don't compile).
- enable ia64-xen (it compiles, but still don't boot).- Fix dlm s/u.generic_ip/i_private/.- IA64 compile fixes- Update xen patch to linux-2.6-xen-fedora cset 34801.
	* linux-2.6 cset 33175
	* no linux-2.6-xen updates.
- Remove xen x86_64 8 cpu limit.- Numerous GFS2/DLM fixes.- new ahci suspend patch- VFS: Destroy the dentries contributed by a superblock on unmounting [try #2]- Wasn't calling weak-modules kT@m> 0.77-5Dan Walsh <dwalsh@redhat.com> 0.77-4Nalin Dahyabhai <nalin@redhat.com> 0.77-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.77-2Nalin Dahyabhai <nalin@redhat.com> 0.77-1Nalin Dahyabhai <nalin@redhat.com> 0.77-0Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.75-48.1Nalin Dahyabhai <nalin@redhat.com> 0.75-49Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com> 0.75-48Tim Powers <timp@redhat.com> 0.75-47Nalin Dahyabhai <nalin@redhat.com> 0.75-46Nalin Dahyabhai <nalin@redhat.com> 0.75-45Nalin Dahyabhai <nalin@redhat.com> 0.75-44Nalin Dahyabhai <nalin@redhat.com> 0.75-43Elliot Lee <sopwith@redhat.com> 0.75-42Than Ngo <than@redhat.com> 0.75-41.1Than Ngo <than@redhat.com> 0.75-41Nalin Dahyabhai <nalin@redhat.com> 0.75-40Nalin Dahyabhai <nalin@redhat.com> 0.75-39Nalin Dahyabhai <nalin@redhat.com> 0.75-38Nalin Dahyabhai <nalin@redhat.com> 0.75-37Nalin Dahyabhai <nalin@redhat.com> 0.75-36Nalin Dahyabhai <nalin@redhat.com> 0.75-35Nalin Dahyabhai <nalin@redhat.com> 0.75-34Nalin Dahyabhai <nalin@redhat.com> 0.75-33Nalin Dahyabhai <nalin@redhat.com> 0.75-32Nalin Dahyabhai <nalin@redhat.com> 0.75-31Nalin Dahyabhai <nalin@redhat.com> 0.75-30Nalin Dahyabhai <nalin@redhat.com> 0.75-29Nalin Dahyabhai <nalin@redhat.com> 0.75-28Nalin Dahyabhai <nalin@redhat.com> 0.75-27Nalin Dahyabhai <nalin@redhat.com> 0.75-26Nalin Dahyabhai <nalin@redhat.com> 0.75-25Nalin Dahyabhai <nalin@redhat.com> 0.75-24Nalin Dahyabhai <nalin@redhat.com> 0.75-23Nalin Dahyabhai <nalin@redhat.com> 0.75-22Nalin Dahyabhai <nalin@redhat.com> 0.75-21Nalin Dahyabhai <nalin@redhat.com> 0.75-20Nalin Dahyabhai <nalin@redhat.com> 0.75-19Nalin Dahyabhai <nalin@redhat.com> 0.75-18Nalin Dahyabhai <nalin@redhat.com> 0.75-17Nalin Dahyabhai <nalin@redhat.com> 0.75-16Nalin Dahyabhai <nalin@redhat.com> 0.75-15Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.75-14Bill Nottingham <notting@redhat.com> 0.75-13Nalin Dahyabhai <nalin@redhat.com> 0.75-12Nalin Dahyabhai <nalin@redhat.com> 0.75-11Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.75-10Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Matt Wilson <msw@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dak`@trootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrookxt@19a73ed082015d33dd2623f5cf5cdd869f13913750d028aef66c37df5bcae444e527eace9eeb308ef83de142ff480f4a7a22b5f97c86a5320808b29e64fd4e2c8db3317ba683eb19709eeb5433209d11ae24ae095497ad8ade3540959e5cabf6a76438450d860833efd54f8f21f52e6536dcf399c22f9dc6040f755c849c8f7f29a9691c8e0babefb929bf8e033b4376b83c7123c9c61b7ded4beef529e2dbb75d2a72c972ae2e3503b064159d77b8478a142eecdb57e4f3637c92b41d4a993aaf5b336011f09d9729c8320f8816a5488cb27ce78b181f569fff62094482617b641d6888edd5c7aee51fe830ac9bab49f0691697461017d81039c7b8b5dcd5c3ee82295e3a285b6048f921d7bed5b3b606064b5c3c9b39f2145510e41a4cc7c9d9e9b4b76ca975f62fc056b3e0904a731ba4225b29ad1e0d8d76f809a04fd74386cf904fe39c2ef070675cbe8964fee426d3658510ae96643c065b07ab2ef4cdeb12058cfc581af8b537e4e6a84c86acebf6bda90efd85690c10902fbaf13bfc2b30c21f7cb8673086628d7a0c158a52e383d12fdeeebf07ebb7c34f97124ba95a80ae0e8e9055ff8f156f6d46b55ebbed5909ebf9173342d47ba1f8bbaf53fe60d73eb0a184f8aa40593046191edacd356a67555729416cd58552b47559b6c47c565ee49a294a6743e4160c07b1217d6db9b22a90455506c6862ccf5bdf5c7cb0dd0b534ca26d2067188e8f8f2c1c8d84544d52bebc29e3fa912d31896ccbcc9f4895ff804022ee8b5f80538efe275c854db0925f2ea54b84bddd760c587f7e9b798b5e5cb31787bf485cfaae03e536ec94bc1186285a90db6fc53fd034f2773c6334c34643e7ab179f27ef1d21585cc0253130db2027d47e63b61fd5f16be56ef2e620e9c7b47029e2d64f7bfdb31a898274f303be8a9f6142c346a4e051670c1c65312e7dc09d0adbcb55cdf6305e268b4a9fb515f7bab4ea30603b546af0e0e78474f96ea599d4b0b73fb67ab4d73499b26d6b044e9f15ef53ad1286432054706a11c94a2658de44776e981c04b6615c02256ce863a65514e00c6fa6d29fa8f4b2c27754f4ebe81effdd1f8c6a8178db9a492369446f84f20ee7b710f66f1d82a05a3fd39da3a87ddc0ea6b3181e3276815be3eda24aa6fed6cc4e214f40732bc3e14516bae809d2fc1aefa71fa47a516a8c6aa778c2cb5a991a11bf36ed5c4e921ebe03d1fbe834301cabf2d2c3401e2fe40bd1c0e39263b3bd212a44db6db506b13edc3820bcbac056fa2a3aabd673dc8fb6c44ce58f819b063e4750f128957d810f2b81d6ebe0906e05c0dffb9a7ffa184e2215b7dd855a82d40aa787a38ea5e8ae297983a7df7ef762cfd1c31bf9dcf21aae5edd49a54eb99c019faccac17a380301abb3c2351008bd2a5f258794bfe5e08829c340d82b77d0dcb93c0e2317ac1978247c586a032e61376765c4a03620435952e5268fc9a2fbdfea7e15b331fa553abdb9bdb771729341fef90c8b4a219edf2131a020797cb3829fa15f3b711c9467e12e6c64cb7a9e74ed8f5e3479aa8725c060f2a2bf1759724126dc718def467319081e280b5d6249ef9718f1eaa1205cbe1a91fe13cb09895d2ff3f1574b0b1ffdfa913bd35d6249ef9718f1eaa1205cbe1a91fe13a96a82526e73714fe6102c62332bf13406f557c713f6a110bd76fbd5d414cb5e728dd224f0684b1d13e38c7809f6d58306f557c713f6a110bd76fbd5d414cb5e8f6a6417f694b1b862777320e8be79e87508374d20dace876b5ff5a8009316e0df2d266f879f6bc79f1e95612689807f9bba9f47a92dba917a797e2b2b79b5fdd0a3323f6949420d8bd15d3ef2a82f82bed3c35462cef795dd6152faebb867a0d0a3323f6949420d8bd15d3ef2a82f82b75372436ca6c283ecd580f9d8e035f6bed3c35462cef795dd6152faebb867a0bde23bf87e450438877ec70165fc57bab2920ec043908acd7416b788887b6d231bb3a5ea6d5d3ac11daa80309be7c6b9bfc43b758f8530c779eb3d53e2d6af8a1d0de58df9c1f57858c67ec843b28e289d9fa9eef1eaeba5821e94f91aaffe651d0de58df9c1f57858c67ec843b28e280d2412be29e49758216074617fc3eb1797ccf880a0367a8e1385b5ec677894ebf52dfbce700455e48d1618bd5f8ef5dcf52dfbce700455e48d1618bd5f8ef5dcc36a27acfff14f1c9f67378c7d90b83ac4cd8a29b90ab623d0d84d0a27fc964db1c6be53e000d00de2b74300f2da7435c4cd8a29b90ab623d0d84d0a27fc964de9837fb2b57368029b38540ebbe67e7b46aa175a38980bf81becc64ae4c9f9f6d25f041657dfc61596bb2afb0a5c0e6046aa175a38980bf81becc64ae4c9f9f64806fd3ed27b7be024ddd7b9b839e111edaed04bffe9f05eeebb29879a2a9575a04622b3a72646b48b238bbdfc888b226990fe2dd9356ddc3a2e226d1dea1dcace47b1d0f59b86692475bba03ab3784b3c7b1e4241799b69f0356bb293dc95d3ba32ff89ec86a2b06484997ef476ff92a47633a625858339b3b5cd7036f52322d27cba13fc8ca33c7284bc613502dddda47633a625858339b3b5cd7036f5232282a8ae643d8ce7e5bd49a2be7cf212934f16f1f59a2115b60fefa3a74be9303ebeb1d0e3e659a981222a3148afd8bc18beb1d0e3e659a981222a3148afd8bc18c2af376657f9e44eb08dbaf9e92234e91b55d7b48ce4383e378bca7a1b1792724f16f1f59a2115b60fefa3a74be930l M
0@000rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootyelp-2.16.0-30.el5_9.src.rpmyelp@@	@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@JJ@/bin/sh/bin/sh/bin/sh/bin/shGConf2GConf2GConf2desktop-file-utilsdesktop-file-utilsgecko-libsgnome-doc-utilsgnome-vfs2gtk2ld-linux-x86-64.so.2()(64bit)ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)libICE.so.6()(64bit)libORBit-2.so.0()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libart_lgpl_2.so.2()(64bit)libatk-1.0.so.0()(64bit)libbonobolibbonobo-2.so.0()(64bit)libbonobo-activation.so.4()(64bit)libbonoboui-2.so.0()(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcairo.so.2()(64bit)libdbus-1.so.3()(64bit)libdbus-glib-1.so.2()(64bit)libdl.so.2()(64bit)libexslt.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgconf-2.so.4()(64bit)libgcryptlibgcrypt.so.11()(64bit)libgdk-x11-2.0.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libglade-2.0.so.0()(64bit)libglade2libglib-2.0.so.0()(64bit)libgmodule-2.0.so.0()(64bit)libgnome-2.so.0()(64bit)libgnome-keyring.so.0()(64bit)libgnomecanvas-2.so.0()(64bit)libgnomeuilibgnomeui-2.so.0()(64bit)libgnomevfs-2.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpg-error.so.0()(64bit)libgthread-2.0.so.0()(64bit)libgtk-x11-2.0.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libmozalloc.so()(64bit)libnspr4.so()(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libpangoft2-1.0.so.0()(64bit)libplc4.so()(64bit)libplds4.so()(64bit)libpopt.so.0()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libstartup-notification-1.so.0()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libxml2libxml2.so.2()(64bit)libxpcom.so()(64bit)libxsltlibxslt.so.1()(64bit)libxul.so()(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)scrollkeeper17.02.0.02.6.02.0.02.0.02.0.22.6.51.1.43.0.4-14.0-14.4.2.3PkW ,@,,n: force dbMatch() h# key to be 32 bit integer (#146477).- more macosx fiddles.
- move global /var/lock/rpm/transaction to dbpath.
- permit fcntl path to be configured through rpmlock_path macro.
- add missing #if defined(ENABLE_NLS) (#146184).- changes to build on Mac OS X using darwinports neon/beecrypt.
- add https://svn.uhulinux.hu/packages/dev/zlib/patches/02-rsync.patch- build against external/internal neon.- mac os x patches (#131943,#131944,#132924,#132926).
- mac os x patches (#133611, #133612, #134637).- upgrade to db-4.3.27.
- revert MAGIC_COMPRESS, real fix is in libmagic (#143782).
- upgrade to file-4.12 internal.- use package color as Obsoletes: color.- automagically detect and emit "python(abi) = 2.4" dependencies.
- popt 1.10.1 to preserve newer.- force *.py->*.pyo byte code compilation with brp-python-bytecompile.builder17.centos.org 14181551506777777777777777777777777777777777777777777777CCr4.4.2.3-36.el5_11rpmgraphrpmargv.hbase64.hdb.hfts.hhdrinline.hheader.hmisc.hrpmal.hrpmbuild.hrpmcli.hrpmdav.hrpmdb.hrpmds.hrpmerr.hrpmfc.hrpmfi.hrpmfile.hrpmgi.hrpmhash.hrpmio.hrpmlib.hrpmlog.hrpmmacro.hrpmmessages.hrpmpgp.hrpmps.hrpmspec.hrpmsq.hrpmsw.hrpmsx.hrpmte.hrpmts.hrpmurl.hstringbuf.hugid.hrpmcachelibrpm.alibrpm.solibrpmbuild.alibrpmbuild.solibrpmdb.alibrpmdb.solibrpmio.alibrpmio.sorpmcache.8.gzrpmgraph.8.gz/usr/bin//usr/include//usr/include/rpm//usr/lib/rpm//usr/lib64//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnu	ASCII C program textASCII English textELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedcurrent ar archivedirectorysymbolic link to `librpm-4.4.so'symbolic link to `librpmbuild-4.4.so'symbolic link to `librpmdb-4.4.so'symbolic link to `librpmio-4.4.so'./01RRRRRRRRR	R
RRR
RRRRRRRRRRRRRRRRRRR	R
RRR
RRRRRRRRRRRRRR?`G!nEq`_+r]7{e?TXGV(H]X(GAJSW_g/>aNI.1$[?TXGV(U"FAYDіmҴcbO6v90^..}]7160eff26acef8c21dd31a9e82bdcd8216a1d1a0\=B\<)Chuuk |6Isle_of_ManbsChungking+Y,|W|ticable.hk`A@3e216a351f7a8d05f8dbfa64bde0cf8d36c2af376657f9e44eb08dbaf9e92234e9b713c8bc4f34637904a47a6dc599535e95996a614db92d34a81d6ab0af89157b31c455cb11d7e54b23956a1c6c1314696990b1ee2ceaae85c155683ffd0a28ffa809001b92b1d27a424ff7ac2d1104f46f09efc6adee102cf4f21b7392d5fae08ec59661738d2680c4a958ff0d992c3b426f72b9b045d1bcd646bbfb2191dd1298176e7d47d928c09f29dd23d5acf814426f72b9b045d1bcd646bbfb2191dd12694bae469379a6fe19834057fa1bf9059554bf55c5dd552c494ee532f0cace3e7ca251dbe20b636da00d8f18ed4ecd6eb4d9ffdf7b98cc389f70ec5cf7dc94af8831a8beff4f9e030774c83ec4fad64f8831a8beff4f9e030774c83ec4fad64f841318427550d86af263cc836ad01afc565f0b1f768b869aa9af8191f424f7a2f464196d232f63f041dc38f305c31af6a870ac27399688ffa2d4b809d9a42327ee681c6db4f9a27147bbb5d75bbcd1b1bf1f0435fc5cb1a27c90c36d8f3712341e81abc1f01d5520869a7000ce0e08731e81abc1f01d5520869a7000ce0e087308f02462ae9993a11d010c8a79668f09b2ad330f26c99d593cbfad2e0dbecaf2dacda02e780a8a80d1feabf5844bd2f2b2ad330f26c99d593cbfad2e0dbecaf2c37f764a59d9e276a759fa3271b78fffefc010a78a7af215a42ed08c8da596a0b752e5ed86bd1e9fecbb6ca440a85e67efc010a78a7af215a42ed08c8da596a042e7b33016dc783e0b5607b7ea19232c26203e3410c578c1a2b8cc88df24ac5b5f35f5f62d4ddb574e6aa35e2afbe1f2e09801297810779f22dbe44d38795ad49a976f3cf176d020b09d2b77e724d9a8cb7e5e72c9c97749c499c9b03e909ef35b5fa1c8d13132a9a2dac49ba43223b18d553fbde2b845f15f3bd2fd82c2af191197b6f7787f314c4a8b4bb498be7f9803a2ff1474e495a1629711ebc52fe225317b89d177257f8cc9beccdce683404db94a70ce0e012ee817c5f9cb8f2b5e18c0ff1ca4caf803a3425320820972181d2601ac7ec78dfefec257ef021950f0e1b43d7e6521f73bc70ef7fb48bf027a0c2601ac7ec78dfefec257ef021950f0e199081d455a92c4ca78782be3b55babdf25e912f01455c42701d6c8c262b112a44468c3bdade5239394fd77199854843022f0b13b13fada6da47bd9ba2dd46bc92c61ee490f337cdb9f6b6ec0dd26682522f0b13b13fada6da47bd9ba2dd46bc9652ab0930dce9d24f672e9332b9f7e3b23e46ad3413e870ed5df6d910d42bb0c2c61ee490f337cdb9f6b6ec0dd266825a85a984f4fce7c5abbf9c1064d67657823e46ad3413e870ed5df6d910d42bb0cc0171251057b52af7dcd5f0678435ab322f0b13b13fada6da47bd9ba2dd46bc922f0b13b13fada6da47bd9ba2dd46bc98c95d790a966e96f740d46ba09d38e11d3cab7067abf6a2ae24683d8961c548fda744917ace492ee127e80083e38224c3165cc0bbd759b0ccf7e504dc3beadb7fbd1a99871320d79171c6dd04bc786dcd2f3c85608f33a69bb05fd5bdffb8c856270cdd2bb89b7389655f907ada9a9bd872fc71f759991f49780ab7361e107db5193f66b4c8c78704d4a36531119cad1230c2951aa72288e49f59baa5f68866177ee51cb0ae1215966ef1e50df69263bdfd9bd2bdfd768323426784a263f454e09dff2f01f1dcf65a21b009256f39f5b72fd5f0e2baf02a8515a340c4f6cd46eca36fc3fff45db335873e0a6f03212eef5ee345cbea8e97bd733e6312f9ed31758625709496107a3724c8904cfd1c23b8b7e7df53c9f572af19e44c0bdcd5cc845a8f8caf8f51719fa11b62e30ce4130fc1cb229648f3c972a6899b670c0bc4e643ac2011b44cee4f88500ce747a48624580e5268ddf10175cdd86f87f481d7123df011ce3d306c61fd29f204ac920a81a065aba3eb4782977773186c622c599d2f2a1d32bede2ddf5976f03df8d75a4f392910e4d9c17d7da6cb58d57189d8ddbe46843befacbc5be9512acb230508941fb1a67324c7a03ffa666d9a7a12f1dc0a7bc9b665124a464c3dc013f17078c8bd8ef771049d3cbf779c7b72f4dbb446889b6fe110414616ed293100ed4cd9def0d15a8bb8033023558b360515c4d3fae07a931eb5fc0ddbc863af3e7b89185414eb5c28a5b3e48218d66b19d7daf9e7d26c7dabdd373155198024d490a4857f8e32ee65ecb31e4e446ba06dfce9ac36e209d9b3a38ba38ae681e0e9bea3ce65f4c2d42d944c21086e831a0ac52b21f156d11392174a988c62e4ff88f949fc9c85f9b90b23870531a6ea800b7b2d995670b60e2f986a60b0d6810fe1709a7e4ccb45bb5ab9dad1c03080f7d2194535d47378cf00e63ec134c1dd7f5161c47db55c5753d9e0796f95c3f3633f076218801bebbbfeb1503d104f22d68f9367f8988a9ecef58f00ddc5775c242c3be525afd663257d105306f4eb84076e1321c45222f6843df54ac68ff06ef517997740eb1300f6a3d34589b3e5e0f11801d3fa5561f55a478fee8efcce9313fc26c5f9012ceae39785da143d95a4784ce2428513a0229858bdf46cbe700e99259c72908ebc0f7eb77f08bd25ece6b7e699dc439a3daeaddd79a21e4b039bb0f7c3ac0328b2021e3414c5aba3764ebedd99f92642befb01b3ce122821fcc8a5618d3cdd247d7830b6c1ca39161533d95f40f4d1bd4b39d0551b6ab3dac30227859698659bd42590eaf1Pj@`@]
- [net] sfc: Remove remnants of on-load self-test (Michal Schmidt) [833600]
- [net] sfc: Remove obsolete function efx_dev_name() (Michal Schmidt) [833600]
- [net] sfc: Update the description of SFC_MTD (Michal Schmidt) [833600]
- [redhat] config-generic: enable CONFIG_SFC_MCDI_MON (Michal Schmidt) [833600]
- [net] sfc: Add hwmon driver on brds with SFC9000-fam controllers (Michal Schmidt) [833600]
- [net] sfc: Clean up test interrupt handling (Michal Schmidt) [833600]
- [net] Partly revert 'sfc: Handle serious errors in exactly ...' (Michal Schmidt) [833600]
- [net] sfc: Remove dep on NAPI polling in efx_test_eventq_irq (Michal Schmidt) [833600]
- [net] sfc: Correct interrupt timer quantum for Siena (Michal Schmidt) [833600]
- [net] sfc: Support getting CAPABILITIES from GET_BOARD_CFG res (Michal Schmidt) [833600]
- [net] sfc: Consistently test DEBUG macro, not EFX_ENABLE_DEBUG (Michal Schmidt) [833600]
- [net] sfc: Remove efx_nic_type::push_multicast_hash operation (Michal Schmidt) [833600]
- [net] sfc: Merge efx_mcdi_mac_check_fault/efx_mcdi_get_mac_faults (Michal Schmidt) [833600]
- [net] sfc: Merge efx_mac_operations into efx_nic_type (Michal Schmidt) [833600]
- [net] sfc: Hold stats_lock while reading mac_stats (Michal Schmidt) [833600]
- [net] sfc: Use new names for MC shared memory layout constants (Michal Schmidt) [833600]
- [net] sfc: Make handling of MC reboot more reliable (Michal Schmidt) [833600]
- [net] sfc: Remove fallback for invalid permanent MAC address (Michal Schmidt) [833600]
- [net] sfc: Rename efx_wanted_channels to efx_wanted_parallelism (Michal Schmidt) [833600]
- [net] sfc: Update MCDI (firmware interface) definitions (Michal Schmidt) [833600]
- [net] sfc: Remove unnecessary inclusion of header file (Michal Schmidt) [833600]
- [net] sfc: Const-qualify static data as appropriate (Michal Schmidt) [833600]
- [net] sfc: Remove parentheses around return expressions (Michal Schmidt) [833600]
- [net] sfc: Avoid assignment in an if-statement (Michal Schmidt) [833600]
- [net] sfc: Fix some formatting errors reported by checkpatch (Michal Schmidt) [833600]
- [net] sfc: fix assignment of 0/1 to bool variables. (Michal Schmidt) [833600]
- [net] sfc: Use skb_fill_page_desc to simp page buff pass to GRO (Michal Schmidt) [833600]
- [net] sfc: Remove device ID macros only used once (Michal Schmidt) [833600]
- [net] sfc: Use kcalloc instead of kzalloc to allocate array (Michal Schmidt) [833600]
- [net] sfc: Add moduleparam.h to drivers as required. (Michal Schmidt) [833600]
- [pci] sfc: Add Solarflare vendor ID and SFC4000 device IDs (Michal Schmidt) [833600]
- [net] sfc: use skb frag size accessors (Michal Schmidt) [833600]
- [net] sfc: Remove driver assignments of ethtool_ringparam fields (Michal Schmidt) [833600]
- [net] sfc: Use correct fields of struct ethtool_coalesce (Michal Schmidt) [833600]
- [net] sfc: Validate IRQ mod params in efx_init_irq_moderation (Michal Schmidt) [833600]
- [net] sfc: Fix reporting/validation of TX interrupt coalescing (Michal Schmidt) [833600]
- [net] sfc: Use consistent types for interrupt coalescing params (Michal Schmidt) [833600]
- [net] sfc: Correct err code for unsupported interrupt coalescing (Michal Schmidt) [833600]
- [net] sfc: Use 64-bit writes for TX push where possible (Michal Schmidt) [833600]
- [net] sfc: Remove 'Communications' after 'Solarflare' (Michal Schmidt) [833600]
- [net] sfc: Remove 'Solarstorm' from Kconfig descriptions (Michal Schmidt) [833600]
- [net] sfc: Fix Siena mac statistics on big endian platforms (Michal Schmidt) [833600]
- [net] sfc: Fix mapping of reset reasons and flags to methods (Michal Schmidt) [833600]
- [net] sfc: Allow resets to be upgraded; use atomic ops for safety (Michal Schmidt) [833600]
- [net] sfc: Remove unneeded version.h include (Michal Schmidt) [833600]
- [net] sfc: Remove casts of void * (Michal Schmidt) [833600]
- [net] sfc: include interrupt.h (Michal Schmidt) [833600]
- [net] sfc: Add appropriate prefetch.h hdr for prefetch users (Michal Schmidt) [833600]
- [net] sfc: Don't use enums as a bitk@ crond service- Add new setkeycreatecon call to pam_selinux to make sure keyring has correct context- revoke keyrings properly when pam_keyinit called as root (#201048)
- pam_succeed_if should return PAM_USER_UNKNOWN when getpwnam fails (#197748)- revoke keyrings properly when pam_keyinit called more than once (#201048)
  patch by David Howells- don't log pam_keyinit debug messages by default (#199783)- drop ainit from console.handlers (#199561)- don't report error in pam_selinux for nonexistent tty (#188722)
- add pam_keyinit to the default system-auth file (#198623)- rebuild- fixed network match in pam_access (patch by Dan Yefimov)- updated to a new upstream release
- added service as value to be matched and list matching to
  pam_succeed_if
- namespace.init was missing from EXTRA_DIST- updated pam_namespace with latest patch by Janak Desai
- merged pam_namespace patches
- added buildrequires libtool
- fixed a few rpmlint warnings- actually don't link to libssl as it is not used (#191915)- use md5 implementation from pam_unix in pam_namespace
- pam_namespace should call setexeccon only when selinux is enabled- pam_console_apply shouldn't access /var when called with -r (#191401)
- actually apply the large-uid patch
- don't build hmactest in pam_timestamp so openssl-devel is not required
- add missing buildrequires (#191915)- upgrade to new upstream version
- make pam_console_apply not dependent on glib
- support large uids in pam_tally, pam_tally2- the namespace instance init script is now in /etc/security (#190148)
- pam_namespace: added missing braces (#190026)
- pam_tally(2): never call fclose twice on the same FILE (from upstream)- fixed console device class for irda (#189966)
- make pam_console_apply fail gracefully when a class is missing- added pam_namespace module written by Janak Desai (per-user /tmp
support)
- new pam-redhat modules version- added try_first_pass option to pam_cracklib
- use try_first_pass for pam_unix and pam_cracklib in
  system-auth (#182350)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- new upstream version
- updated db4 to 4.3.29
- added module pam_tally2 with auditing support
- added manual pages for system-auth and config-util (#179584)- remove 'initscripts' dependency (#176508)
- update pam-redhat modules, merged patches- fix dangling symlinks in -devel (#175929)
- link libaudit only where necessary
- actually compile in audit support- support netgroup matching in pam_succeed_if
- upgrade to new release
- drop pam_pwdb as it was obsolete long ago
- we don't build static libraries anymore- rebuilt- pam_stack is deprecated - log its usage- fixed CAN-2005-2977 unix_chkpwd should skip user verification only if
  run as root (#168181)
- link pam_loginuid to libaudit
- support no tty in pam_access (#170467)
- updated audit patch (by Steve Grubb)
- the previous pam_selinux change was not applied properly
- pam_xauth: look for the xauth binary in multiple directories (#171164)- Eliminate multiple in pam_selinux- Eliminate fail over for getseuserbyname call- Add getseuserbyname call for SELinux MCS/MLS policy- pam_console manpage fixes (#169373)- don't include ps and pdf docs (#168823)
- new common config file for configuration utilities
- remove glib2 dependency (#166979)- process limit values other than RLIMIT_NICE correctly (#168790)
- pam_unix: always honor nis flag on password change (by Aaron Hope)- don't fail in audit code when audit is not compiled in 
  on the newest kernels (#166422)- add option to pam_loginuid to require auditd- fix NULL dereference in pam_userdb (#164418)- fix 64bit bug in pam_pwdb
- don't crash in pam_unix if pam_get_data fail- more pam_selinux permissive fixes (Dan Walsh)
- make binaries PIE (#158938)- fixed module tests so the pam doesn't require itself to build (#163502)
- added buildprereq for building the documentation (#163503)
- relaxed permissions of binaries (u+w)- upgrade to new upstream sources
- removed obsolete patches
- pam_selinux modulel@8.@... off 'modules.conf is more recent than modules.dep' message (#14276,
  others)
- return nonzero from depmod if there are errors (#40935)
- fix manpage typo (#33123)- new S390 patch from IBM- Add modutils-2.4.5-stblocal.patch from Jakub. See the e-mail message
  inside the patch file for details.
- Use smp_mflags macro- add s390/s390x support- update to 2.4.5- add default post/preun for binfmt_misc- change ipv6 alias to 'alias net-pf-10 off'- add 'net-pf-10 ipv6' alias (#25405)- change "#ifdef s390" -> "#if defined(__s390__) || defined(__s390x__)"- update to 2.4.2
- ship a genksyms.old- fix ppp aliases- oops, I blew away other people's changes. Fix that.
- only have tty-ldisc-11 in the aliases once- update to 2.4.0
- tweak irda aliases
- remove vixie-cron dependency (it's not *required*)
- add missing %build
LANG=C
export LANG
unset DISPLAY
 (where did that go?)- 2.4.0
- Get rid of obsolete char-major-60==ircom-tty patch
  (moved to 161)- add "ctc{0,1,2} -> ctc" alias for s390- add missing comma in alias list
- add irda aliases- add char-major-108 ppp_async alias- fix ide-probe aliases (now ide-probe-mod)- 2.3.21, fixes more security problems.- 2.3.20, fixes security holes- 2.3.19
- add IrDA devices to alias patch
- update source URL- fix ia64 module loading- stupid ia64 tricks- upgrade to 2.3.17.
- sparc64 ELF hacks.- Use /usr/share/man for removing kerneld-related man pages.- fix build on SPARC- update to 2.3.14- update to 2.3.13
- turn psaux off again
- remove sound patch; it's obsolete- rebuild to cope with glibc locale binary incompatibility- 2.3.12
- fix up ia64- automatic rebuild- add aliases for cipcb[0-3]- fix build on combined 32/64 bit sparc- modules.confiscation- add ia64 patch from Intel- fix build with glibc 2.2- Correct %description to reflect that we don't build kerneld by default- 2.3.11- fix net-pf-* aliases for ipx, appletalk- 2.3.10- added alias for agpgart- hardcode psaux alias to off everywhere- add a symlink from conf.modules.5 to modules.conf.5- fix breakage *correctly*- fix breakage of our own cause w.r.t sound modules- update to 2.3.9.
- port RH patches from 2.1.121 to 2.3.9 where needed.
- disable warning about conf.modules for now, in 7.0
  we should move to modules.conf.- hardcode psaux alias on sparc to off.- hardcode parport aliases....- rebuild against new glibc in the sparc tree- rewrite sparckludge so that separate *64 binaries
  are not needed anymore.- apply the last patch in the %prep section (doh!)- add support for the ppp compression modules by default- add cron.d file to run rmmod -as- take out kerneld- add patch to make all raid personalities recognized- auto rebuild in the new build environment (release 7)- obsoletes modules
- get rid of the /lib/modules/preferred hack- added support for /lib/modules/foo/pcmcia
- make kerneld initscript not start by default- added sparc64 support from UltraPenguin- call libtoolize to allow it to compile on the arm- search /lib/modules/preferred before defaults but after specified paths.- upgraded to version 2.1.121- added -m, -i options- fix syntax error I introduced when enhancing initscript- enhance initscript- recompile statically linked binary for 5.2/sparc- pick up ultrapenguin patches (not applied for now).
- pre-generate keyword.c so gperf doesn't have to be present (not applied).
- util/sys_cm.c: fix create_module syscall (signed return on sparc too)- correct %postun typos- added /lib/modules/preferred to search path- translations modified for de, fr, tr- updated to 2.1.85
- actually make use of the BuildRoot- Fix sparc64, add modinfo64 on sparc.- Handle EM_SPARCV9, kludge to support both 32bit and 64bit kernels
  from the same package on sparc/sparc64.- removed warning message when conf.modules exists and is a empty- patched to honor -k in options
- added modprobe.1
- added init script- removed bogus strip of lsmod (which is a script)- updated to 2.1.55
- builds in a buildroot- added insmod.static- built on Intel
- combined rmmod and inqkf	@f	g	e	es AC_DEFUN_ONCE.- trim docs- version bump
  - Sort rm commands output for mostlyclean-generic, clean-generic, distclean-generic and maintainer-clean-generic, so that the produced Makefile is not sensitive to the way Perl sorts its hashes.
  - Support `+' in the name of directories given to `include'.
  - Preserve spaces in the arguments of `compile'.
  - `missing' will no longer try to emulate a tool that is run with `--version' or `--help' as argument.
  - There is a new chapter about the history of Automake.- version bump
  - Adjust #line directives in `parser.h' (when ylwrap is not used). (PR/432)
  - Fix definition of YLWRAP when ylwrap is installed in a default aux directory found in a parent package.
  - Properly recognize AC_CANONICAL_BUILD and AC_CANONICAL_TARGET.- version bump- rebuilt- update to 1.8.5- update to 1.8.4- update to 1.8.3 bugfix release- rebuilt- 1.8.2 bugfix release
- do not pass VERBOSE=xNO to "make check" as non-empty means be verbose- update to 1.8 release
- require autoconf 2.58 or later
- don't use %configure for now to prevent very recent configure from running
  "config.sub noarch-redhat-linux"- update to 1.7.9 bugfix release
- require autoconf 2.54 or later- update to 1.7.8 bugfix release- update to 1.7.7 bugfix release- update to 1.7.6 bugfix release- update to 1.7.5 bugfix release- update to 1.7.4- update to 1.7.3
- python dir lib64 patch no longer needed
- build requires Autoconf 2.54 or later- patch from 1.7-branch to try python distutils for setting pythondir (#80994)- rebuilt- Fix unpackaged file- add "--without check" rpmbuild option to switch "make check" off
- exclude info dir file
- don't gzip info files explicitly- use api_version in version- bug fix release 1.6.3- add buildrequires autoconf 2.52 or greater [reported by Edward Avis]- 1.6.2 (bug fix release)
- do "make check" after building- automated rebuild- 1.6.1- new package based on automake15
- 1.6- better aclocal versioning- don't version datadir/automake- version suffix programs and data directories
- own symlinks to programs and /usr/share/aclocal- automated rebuild- Completely back out the fix for #56624 for now, it causes more problems
  than it fixes in either form.- Don't use AS_DIRNAME, it doesn't work.- Patch depout.m4 to handle makefiles passed to make with "-f" (#56624)- Update to 1.5 - much better to coexist with autoconf 2.52...
- Fix specfile
- No patches- dont raise error when there is source in a subdirectory (bug #35156).
  This was preventing automake from working in binutuls/gas 
  [patch from HJ Lu <hjl@gnu.org>]
- format long lines of output properly with backslash + newlines as in 1.4
  (bug #35259) [patch from HJ Lu <hjl@gnu.org>]- 1.4-p5, fixes #48788- add the patch from #20559
- really update to 1.4-p4- update to 1.4-p4- Version 1.4-p1 to work with libtool-1.4- automatic rebuild- FHS packaging.- fix bug #8870- revert to pristine automake-1.4.- arm netwinder patch- Injected new description and group.- add patches from CVS for 6.0beta1- update to 1.4.- update to 1.3b.
- add URL.- translations modified for de, fr, tr- updated to 1.3- added BuildRoot; added aclocal files- made it a noarch package- Fixed some tag lines to conform to 5.0 guidelines.- updated to 1.2- first version (1.0)/bin/sh/bin/shbuilder17.centos.org 1410974102FHFHFGFGFFOFPFQFRFSFTFUFVFWFXFYFZF[F\F]F^F_F`FaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrFsFtFFuFvFwFxF
lP.@...ng the
  queue regularly.- /etc/sysconfig/sendmail- recompile statically linked binary for 5.2/sparc- translations modified for de, fr, tr- enhanced initscripts- added a rmail patch- argh!  Fixed some of the db1 handling that had to be added for glibc 2.1- added support for db1 on SPARC- added chkconfig support
- various spec file cleanups
- changed group to Networking/Daemons (from Daemons).  Sure, it runs on
  non networked systems, but who really *needs* it then?- made /etc/mail/deny.db a ghost
- removed preun that used to remove deny.db (ghost handles that now)
- NOTE: upgrading from the sendmail packages in 4.8, 4.8.1, and possibly
  4.9 (all Red Hat betas between 4.2 and 5.0) could cause problems.  You
  may need to do a makemap in /etc/mail and a newaliases after upgrading
  from those packages.  Upgrading from 4.2 or prior should be fine.- made aliases.db a ghost- fixed preuninstall script to handle aliases.db on upgrades properly- fixed post-install output and changed /var/spool/mqueue to 755- fixed /usr/lib/sendmail-cf paths- updated to 8.8.7
- added some spam filtration
- combined some makefile patches
- added BuildRoot support- marked initscript symlinks as missingok
- run newalises after creating /var/spool/mqueue- built against glibc, udated release to -6 (skipped -5!)- Added -nsl on the Alpha (for glibc to provide NIS functions).- Added nis support.builder17.centos.org 1426495329BBJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ	J
JJJJJJJJJJ!J*JJ:JBJJJ
J#JJ0JAJJJ/J@J$J%J J;J=J9J5JJ?JJJ2JJ"J7J.J1JJ6JJ4J3JJ'J)J<JJ,J8J&JJ-JJ+J(JJ>JBJCJDJEJHJFJIJG8.13.8-10.el5_11	



sendmail-cfREADMEcfBuildMakefileREADMEchez.cs.mcclik
@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrooky,@,,,odule
- finish cleanup of the python bindings
- allow conditional builds of modules so that we can build without
  all of the prereqs for all of the modules- add error reporting facilities
- split public header into pieces by function
- backend cleanups- make %{name}-devel require %{name} and not %{name}-devel- clean up quota bindings some more
- finish most of the ldap bindings
- fix a subtle bug in the files module that would show up when renaming accounts
- fix mapping methods for entity structures in python- get bindings for prompts to work correctly
- clean up some of the add/remove semantics (set source on add)
- ldap: implement enumeration
- samples/enum: fix the argument order- clean up python bindings for quota- finish up python bindings for quota support- finish up quota support libs- start quota support library to get some type safety- start looking at quota manipulation- add functions for enumerating users and groups, optionally per-module
- lusermod.c: -s should specify the shell, not the home directory- finish the python bindings and verify that the file backend works again- remove a redundant check which was breaking modifications- finish adding setpass methods- get a start on some Python bindings- make binary-incompatible change in headers- add doxygen docs and a "doc" target for them- add a "quiet" prompter
- add --interactive flag to sample apps and default to using quiet prompter
- ldap: attempt a "self" bind if other attempts fail
- krb5: connect to the password-changing service if the user principal has
  the NULL instance- the great adding-of-the-copyright-statements
- take more care when creating backup files in the files module- add openldap-devel as a buildprereq
- krb5: use a continuous connection
- krb5: add "realm" config directive
- ldap: use a continuous connection
- ldap: add "server", "basedn", "binddn", "user", "authuser" config directives
- ldap: actually finish the account deletion function
- ldap: don't send cleartext passwords to the directory
- fix naming attribute for users (should be uid, not gid)
- refine the search-by-id,convert-to-name,search-by-name logic
- fix handling of defaults when the config file is read in but contains no value
- implement an LDAP information store
- try to clean up module naming with libtool
- luseradd: pass plaintext passwords along
- luseradd: use symbolic attribute names instead of hard-coded
- lusermod: pass plaintext passwords along
- lgroupadd: pass plaintext passwords along
- lgroupmod: pass plaintext passwords along
- add libuser as a dependency of libuser-devel- initial packaging/sbin/ldconfig/sbin/ldconfig\\\\\\\\\\\\\\\\\\\\]	]
]]]
]]]][[[[[[[[[[[[[[[[[[[[\\\\
\
\\\\\\\"\%\(\+\.\1\4\7\:\@\=\C\F\I\L\O\U\R\X\[\^\a\d\g\j\m\\\\\\\\\\\]\arbgbnbncacscydadeelenesetfifrguhehihrhuhyidisitjakakokulomkmlmrmsmynbnlnoorpaplptptrusiskslsqsrsr@Latnsvtatrukurvizhzh0.54.7-3.el50.54.7-3.el5	

 !"#$%&'()*+,-./0123456789:;<=>?@k@9bbebbe526c3a6d9606066f3f3f46f96ee8ca121e31274fddb20b4ea37954b362bfbd9e1574a9edc5328604f9bb5c61d51a4e44bc737e4995b6b9fe0ddc39cd05661d4c58723688ebed10720c1218f37dd029747a19cd4fb228f0e7b287e5ca1f0db3a4b6c5cf1e821294f2e8f595775fb42903cf4a24ec33d1410cfb04b91172e651643fdc8736060ab5864bb48776534ccf369525d46c8dbd9161fea1e800657af759880d4286a8d506249db22ec19af60def946b8d1174aab628a21e823f90b33f78a24b72b78a6ce3b324e8602c6dcd6d47203df7a8592f7e469adede308c53dcbe2f416396f28268989258d276babdf4c52f4a7927ec6962519627df9296be76d19f426890279c6f1082b667bd784743e379915abc10ccaf9978eeaf269dbf3b2a1c453396d77008cc7e48ffacfd9605ab2e532d5e73bfdd07856e2e8346be70715493beeb010e218f16f20dd1d63f413c9797da28cfff76bcf545cc9af9183fc60d030f793575c7a7875d01d0d4162f39b8f87d6d5e53c320fea19832a70b2d1dacc0c0829caa473cef563ade2f22066ef036edb1a6c3cc63f95de267937e0acb2883f5a748a15dcd7d0117a902e263400bf2abc94f2ceb288fbcb7a57ced4c196cd6c1029db9305b69b832ebc25e1f137ebf5202a23b4dab0eac107a8c7d386e6847546b5996890be341dc40c5e8d1474a8ddccee74163816ec74f1af50ce84b9605dde522466f040a7c335b73d43f5cd88ed5f9e0b56ae8b50fa8b7c2ae287c36fc2c387e146a2eef8140c45897a299e7fd2cccdec5091b75c8857ebde4b275b165118c3e6a2ceeb082f0b373f9c5df36cf3371b6e6cf6c691b3f46ad99e65955e624519c950642a8ec572e31f399e3ad183b2bd3cfa9cae3ab698562a2f285ad1ef572a8bc4305da16b37f6466e56462a31ffc87f42853543de3adfca96cfcb016504c9b0617195dbd38cba83401398adb94487e272ec86d58ccd453b7f96a4b440490ab769eaf91fc1306dfc724794e9013d3aad41aff7ef5a5b38f906b25d2792803707049b8c84bda990e92e003d1a2a563fa4cf680dd0a37be17329cba7364dde927b7bc390f47063d23d0d9d4e144fb6ff03651223fcc66654f344d93d136be6bd05e1d5a88261f33509dc6ac0f5475320db3545b0ef8917b954815b729751654a17f2e16d6543da1b79bdb93e2b2ee8a5e1638865b5e3294055e1ffe3e699c0651fb19218c2902acd14d1285d35859e99a91bab9d9a7f2ac9062acf4bcfe2f8712f83559d2743b9597fa59ddc55f4f78ec3a3024149ddc094a379b0ab3c702f7e8f58326495d21bbe39598146de05dddeed50201970c7649930df4d20efef90708d8d6dc9d31579851d43eced1881f20fda0add47c3542c4a8f41a93b6fb47b0437359cd190e852c3d705090c346537ab7f48c8f2382bcf64d3ef671b8109b347181a60ae4fdac84aa478db2c3c2a94b6313d144e2c1ba821be3d488dc7c91d92a0c5183e7f3059cb2eedd3edc0e229752868535f35328536e5af720477fe1019c42ba8eea55b772bb23b7b3e9a38c0d78b5e8edfffd61af96a7c5885d9931e9eb4ea221fef0dbb821b9ee37be21cc0d78b5e8edfffd61af96a7c5885d993fe2a7e06c8138485496d51fd07b6c1570f5c6f076fe5735131b61da9b5b8afb7fe2a7e06c8138485496d51fd07b6c157158c685cd1e5c9458573401b2f65d79f7dbf750bae0aadedade7369fc0de07e1b239fc692d9ea77dec10f331806fcbbdf7028e624deaaa55127d724dd39073304583cce282c7fce825aa9ec7f71a00760cdcfa5e9b1901648f09079766cb0a0718b5034d658853348c7a84156d5c3a2d7aac3c5526c22ca2eabe667220d0915969f7b1ed4e170438f9daf3f9f84649e048c6341811866c8d76bf0b71eb0e4896../../vim/vim70/docvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzvim.1.gzmenu_ja_jp.ujis.vimk`/.@/.0.H4?3d
		V	$PV`  	  
`   
 `   	<	P	'TX_(c8lK9K:<KF*G* H+( I+ X+Y+\+ ],p ^-b.d/4e/9f/>k/@l/Gt/` u/ v0`	w1 x24 y2B{3 334A4AA
444 4g4h4Cquota3.138.el5System administration tools for monitoring users' disk usage.The quota package contains system administration tools for monitoring
and limiting user and or group disk usage per filesystem.Pbuilder10.centos.orgCentOS-5CentOSBSDSystem Environment/Basehttp://sourceforge.net/projects/linuxquota/linuxx86_64"
va
0:0!ppMm	1wl@vWcā큤큤PtPtPtPtPtPtPtPtPtPuPuPuPuPuPuPtPtPtPtPtPtPtPtPtPuPtPtPtPuPtPtPt0b4a5484e590fea00f9949d6e298a659d88f3d030277b1dbdd72fab044a1ba28f8552e3ed3ee5d30a045b358ecfe85b2871e0103a8d6aa54fee6d811e96e2fa079c8ccaa114c76c0e78dbbdefe223f190c2f01bb96e6f31423174d65a045bd330656a40cf7a698e8eb925c08fb3e603a506dc00adc4f5105b371d3c1ffa9002d20a872d77829a2a624e742c006d94ed677ee4ec9c0371064fe63253fd608ec11ead17848213c5c265716763da5c6c358ee91eb00d8797a110c727c35ce828ce5c6594f34f9656f6ed7dc3a9b0606675f5e910bfaab44040761d8739c1be7f8a11832127ec615043ea261dd83d82e97d6f39bc4d93110238886c1d5206735e2989322d476450efeba0a63af2bb58c7f2abe3e3620b003b3a13097ad4ab144df61d9d3350a04a4f4babdbdb240d130db641c09a001b5055074d64782a8053da179ae37453ab91a902236fcd96eb0158bab1e7e0c0e4e3d7fdbad68a4da331d2973dbb2a210558fd97199b12a2f3de2989951b7ce1238c62ea86ad7dc8a90fbbf1fe0a36a24cdbabd57b0503b257947c8fe59a25f12455bffe2c37f788bd4869c4c0e978e70bc235fc4f8543b6833ad850a498bfb71ed946234c3d129acbd2404ccfc9e2c2bae17f31b221572d9825c34e8quotaonquotaon.8.gzrquotad.8.gzrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootquota-3.13-8.el5.src.rpmconfig(quota)quota@@@@@@@@@@@@JJ@config(quota)initscriptslibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err.so.2()(64bit)libext2fs.so.2()(64bit)liblber-2.3.so.0()(64bit)libldap-2.3.so.0()(64bit)libresolv.so.2()(64bit)libssl.so.6()(64bit)libwrap.so.0()(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)1:3.13-8.el56.383.0.4-14.0-1kernelj P~@stuck messages on guests (Don Zickus) [455323]
- [misc] nmi_watchdog: add /proc/sys/kernel/nmi_watchdog (Don Zickus) [455323]
- [misc] scripts: use system python instead of env (Don Zickus) [521878]
- [pci] sr-iov: fix broken resource alignment calculations (Don Dutile) [523341]
- [pci] clean up resource alignment management (Don Dutile) [523341]
- [pci] sr-iov: assign pci resources earlier (Don Dutile) [523341]
- [net] vxge: update version to reflect RHEL5.6 changes (Bob Picco) [580413]
- [net] vxge: set func_id 0 as privileged for normal func (Bob Picco) [580413]
- [net] vxge: fix MSIX interrupt configuration (Bob Picco) [580413]
- [net] vxge: fix ethtool -d output (Bob Picco) [580413]
- [net] vxge: align tmemory only if misaligned (Bob Picco) [580413]
- [net] vxge: fix hw buffer starvation from short packets (Bob Picco) [580413]
- [net] vxge: fix receive stall w/ driver/chip out-of-sync (Bob Picco) [580413]
- [cpufreq] add APERF/MPERF support for AMD processors (Bhavna Sarathy) [621335]
- [xen] vmx: fix handling of FS/GS base MSRs (Michal Novotny) [613187]
- [xen] hv: improve backtrace support on ia64 (Andrew Jones) [499553]
- [xen] support new AMD family 0x15 CPU and NB hardware (Bhavna Sarathy) [619092]
- [xen] allow dom0 to control core performance boost (Bhavna Sarathy) [568771]
- [xen] add support for dom0 to access APERF/MPERF for AMD (Bhavna Sarathy) [568772]- [sound] ALSA HDA driver update for RHEL5.6 (Jaroslav Kysela) [592199]
- [net] igbvf: update to latest upstream for RHEL5.6 (Stefan Assmann) [566028]
- [net] igb: update igb driver to support Portville ACS (Stefan Assmann) [566024]
- [net] igb: fix error in igb AER code (Stefan Assmann) [612212]
- [ata] libata: fix suspend/resume for ATA SEMB devices (David Milburn) [622559]
- [ata] sata_mv: msi masking fix (David Milburn) [554872]
- [ata] sata_mv: Properly initialize main irq mask (David Milburn) [554872]
- [ata] sata_mv: remove bogus nsect restriction (David Milburn) [554872]
- [ata] sata_mv: don't read hc_irq_cause (David Milburn) [554872]
- [ata] sata_mv: add the Gen IIE flag to the SoC devices (David Milburn) [554872]
- [ata] sata_mv: don't issue two DMA commands concurrently (David Milburn) [554872]
- [ata] sata_mv: safer logic for limit warnings (David Milburn) [554872]
- [ata] sata_mv: warn on PIO with multiple DRQs (David Milburn) [554872]
- [ata] sata_mv: enable async_notify for 60x1 Rev.C0 and up (David Milburn) [554872]
- [s390] zfcp: Do not print bit mask as link speed (Hendrik Brueckner) [619857]
- [s390] dasd: force online does not work (Hendrik Brueckner) [619466]
- [s390] dasd: allocate fallback cqr for reserve/release (Hendrik Brueckner) [619465]
- [s390] qeth: wait for finished recovery (Hendrik Brueckner) [619456]
- [s390] qeth: avoid loop if ipa command response missing (Hendrik Brueckner) [619451]
- [s390] zfcp: no force close when port is already closed (Hendrik Brueckner) [612263]
- [s390] zfcp: Do not unblock rport from REOPEN_PORT_FORCED (Hendrik Brueckner) [612266]
- [s390] zfcp: Fail erp after timeout (Hendrik Brueckner) [612261]
- [message] fusion: update to 3.4.15 (Tomas Henzl) [568292]
- [net] ipv6: reroute packets after netfilter mangling (Thomas Graf) [517327]
- [scsi] lpfc: update driver from 8.2.0.76.1p to 8.2.0.77 (Rob Evers) [603806]
- [virt] xenbus: avoid deadlock unregistering xenbus watch (Paolo Bonzini) [429102]
- [ia64] kdump: prevent hang on INIT interrupt during boot (Neil Horman) [506694]
- [net] qla3xxx: fix oops on too-long netdev priv structure (Neil Horman) [620508]
- [kprobes] kretprobe: set status to fix fault handling (Josh Stone) [615121]
- [net] bonding: fix a race in calls to slave MII ioctls (Flavio Leitner) [621280]
- [virt] xen-kernel: improve backtrace support on ia64 (Andrew Jones) [499553]
- [acpi] thinkpad-acpi: lock down video output state access (Don Howard) [607037]
- [fs] xfs: fix untrusted inode number lookup (Dave Chinner) [624862]- [mm] accept an abutting stack segment (Jiri Pirko) [607858] {CVE-2010-2240}
- [fs] fix dcache accounting bug (Josef Bacik) [596548]iЊ0#@##H\?pd		K	>DK4	L
d
Tt


(89`:	G>
'@
/F
7G
XH
I
X
Y
\
]^bpdefkltuDvtwxyL{dAA
@DPgThXCifd-egate0.0517.el5Axalto Egate SmartCard device driver for PCSC-liteThe Axalto Egate device driver enables PCSC-lite to communicate with Axalto
Egate cards, which CoolKey is based off of.OEdbuilder10.centos.orgCentOS-5CentOSBSD/LGPLSystem Environment/Basehttp://secure.netroedge.com/~phil/egate/linuxx86_64[ -x /etc/rc.d/init.d/pcscd ] && /etc/rc.d/init.d/pcscd try-restart >/dev/null || :[ $1 -gt 0 ] && [ -x /etc/rc.d/init.d/pcscd ] && /etc/rc.d/init.d/pcscd try-restart >/dev/null || :+g1	AAA큤AA큤OEdOEdOEdOEdOEdOEd>,>9?>,>6>9I823e675e87407e5f8a37bac4bc08013d84d4802cd7230fbbaf639f0c42a8c95cbbb461211a33b134d42ed5ee802b37ff6f04f5d5b26a4b397185ac2bffc66da4e9d76dc0303063d4af8e554744cc4a275182626a9e799de2e9a0e114e76c0cc619ebeb9ea4058a7f69e00da1cb1cfee9f4b68534e521d25f0ca72d835cb22f44rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootifd-egate-0.05-17.el5.src.rpmlibifd_egate.so()(64bit)pcsc-ifd-handlerifd-egate@@@@@@@@JJ@/bin/sh/bin/shinitscriptsinitscriptslibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libusblibusb-0.1.so.4()(64bit)pcsc-literpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)0.1.73.0.4-14.0-14.4.2.3NJ`N`EEE`DDD`DpDD`DDt`DkDH`AAABob Relyea <rrelyea@redhat.com>     0.05-17Bob Relyea <rrelyea@redhat.com>     0.05-16Bob Relyea <rrelyea@redhat.com>     0.05-15Bob Relyea <rrelyea@redhat.com>     0.05-14Florian La Roche <laroche@redhat.com>Florian La Roche <laroche@redhat.com> - 0.05-12Bob Relyea <rrelyea@redhat.com>     0.05-11Jesse Keating <jkeating@redhat.com> - 0.05-10.1Bob Relyea <rrelyea@redhat.com>     0.05-10Bob Relyea <rrelyea@redhat.com>     0.05-9Bob Relyea <rrelyea@redhat.com>     0.05-8Bob Relyea <rrelyea@redhat.com>     0.05-7Bob Relyea <rrelyea@redhat.com>     0.05-6Bob Relyea <rrelyea@redhat.com>     0.05-5Bob Relyea <rrelyea@redhat.com>     0.05-4Bob Relyea <rrelyea@redhat.com>     0.05-3Bob Relyea <rrelyea@redhat.com>      0.05-2- Fix dist flag- Fix spurious error message
- Fix Failure to Build from Source problem- Fix slow hub issues- Fix multiple card support- the post/postun code at least needs inintscripts installed- fix excludearch line- Fix long standing incorrect error message. patch by tmraz- rebuild- remove s390 from the build- integrate review comments:
- rename timing patch.
- make libusb-version a define.
- use pkg-config to find the appropriate flags and directories for pcsc-lite
- fix service restart to be more friendly
- remove mak0x@((;~\D.;(]K(47`P˝Q.aa39eaa5fd1e1f258051a43dbc966ce2da92e206\<&\<odify PAM setup to use system-auth- expunge all mentions of kerberos authentication or DES encryption using
  kerberos from the man pages- switched to xinetd- rebuild for sparc baud rates > 38400.- make rlogin still work correctly when argv[0] = "rsh"- workaround (by explicitly prompting for password) #4328 and #9715.- mark pam config files as %config.- handle compressed manpages- fix description- remove bogus rexec binary when building; it causes weirdness- Make sure that rshd is compiled with -DUSE_PAM.- Fix bug in rshd (hangs forever with zombie offspring) (#8313).- fix the PAM fix yet again (#8133).- split client and server- update to 0.16.
- dup setuid bits into files list.- update to rexec-1.5 client (#4262)- fix broken rexec protocol in in.rexecd (#2318).- rcp with error was tricked by stdarg side effect (#2300)- rlogin pam file was missing comment magic- strip rexec- rexec needs pam_set_item() (#60).
- clarify protocol in rexecd.8.
- add rexec client from contrib.- auto rebuild in the new build environment (release 22)- compile for 6.0.- translations modified for de, fr, tr- built against new ncurses- Packaged for RH5.0 (Hurricane)- new pam conventions- initial buildbuilder10.centos.org 1253573562tftftfMtftftftftf0.17-40.el5rcprexecrloginrshrcp.1.gzrexec.1.gzrlogin.1.gzrsh.1.gz/usr/bin//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippeddirectory
RRRRRRRR	RRRRR	RRRRRRR	RRRRRR	?p欦C9Gq?JGV(KawI}6ģ^0܁&q;/ۅmI?JGV([J›"cЉw&l
j%n~{33f0ca9b6a865f455e2f2addf7d5129825fb6147cO2" O164bit)8gdbm1libacl.so.1(ACL_1.1)(64bit)/libelf.so.1(ELFUTILS_1.4)(64bit)/libelf.so.1()(64bit),libsepol),libsmime3.so(NSS_3.4)(64bit))libnss3.so(NSS_3.7)(64bit))	libnss3.so(NSS_3.11.7)(64bit))libfreebl3.so(NSSprivate_3.11)(64bit)(mozilla-nspr'libxml2 db4expatatkglib2*rtld(GNU_HASH)libpthread.so.0(GLIBC_2.4)(64bit)libanl.so.1()(64bit)libCNS.so()(64bit)UTF-16.so()(64bit)ISO8859-7.so()(64bit)IBM865.so()(64bit)rIBM285.so()(64bit)nIBM278.so()(64bit)aIBM1167.so()(64bit)TIBM1149.so()(64bit)DIBM1123.so()(64bit)>IBM1026.so()(64bit)+EUC-KR.so()(64bit)$EBCDIC-UK.so()(64bit)!EBCDIC-IS-FRISS.so()(64bit)CP932.so()(64bit)CP10007.so()(64bit)BIG5HKSCS.so()(64bit)config(glibc-common)	nashkernel-headers	libgcc_s.so.1(GCC_4.2.0)(64bit)kpH;@t.com> 2.2-30Nalin Dahyabhai <nalin@redhat.com> 2.2-29Nalin Dahyabhai <nalin@redhat.com> 2.2-28Nalin Dahyabhai <nalin@redhat.com> 2.2-27Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2-24Nalin Dahyabhai <nalin@redhat.com> 2.2-23Nalin Dahyabhai <nalin@redhat.com> 2.2-21.1Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2-21Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2-19Nalin Dahyabhai <nalin@redhat.com> 2.2-18Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2-15Nalin Dahyabhai <nalin@redhat.com> 2.2-14Nalin Dahyabhai <nalin@redhat.com> 2.2-13Nalin Dahyabhai <nalin@redhat.com> 2.2-12Nalin Dahyabhai <nalin@redhat.com> 2.2-11Nalin Dahyabhai <nalin@redhat.com> 2.2-10Nalin Dahyabhai <nalin@redhat.com> 2.2-9Nalin Dahyabhai <nalin@redhat.com> 2.2-8Nalin Dahyabhai <nalin@redhat.com> 2.2-7Nalin Dahyabhai <nalin@redhat.com> 2.2-6Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jakub Jelinek <jakub@redhat.com>- build without strict aliasing (internal build tooling)- pull in fix for a memory leak in nss_db (#1163493)- import Kees Cook's patch to fix accidental leakage of part of ./DB_CONFIG
  (#580543, CVE-2010-0826)- correct a copy/paste error which blamed jkeating for the previous change- when setting file contexts for creation of new files, only fail outright
  if we were in enforcing mode and the file needed to be given a specific
  label (#368281)- rebuild- add missing 'ed' builddep
- set LDFLAGS and CPPFLAGS so that our local copy of DB is more likely to be
  found by the configure script- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- own the soname symlink which we provide in /%{_lib} (#169288)
- drop compat subpackage completely- update to db 4.3.28
- correct a use of uninitialized memory in the bundled libdb (Arjan van de Ven)
- obsolete the compat package, which is useless because current glibc wouldn't
  use it anyway- set errno to ENOENT by default so that we don't leave stale errno values
  around in error cases (#152467)
- clear the entire key DBT before handing it to a get() function- set errno to ENOENT when returning NSS_STATUS_NOTFOUND (#152467, Dave Lehman)- rebuild with new gcc, missed it by that much- update to DB 4.3 (#140094)
- add sample getent-based makefile as a doc file
- pass S_IFREG to matchpathcon() to properly match contexts which are earmarked
  for only files- give makedb support for setting labels on files, and use it (#136522)- set _filter_GLIBC_PRIVATE instead of overriding findrequires, so that file
  colors get marked correctly (originally #128436)- only provide a -compat subpackage on platforms where glibc provides
  compat NSS modules (%{ix86})
- make -compat depend on the same version of the non-compat package- rebuilt- rebuilt- rebuilt- disable use of RPM's internal dependency generator, which was preventing
  the filtering out of glibc private dependencies (#112849)- find bundled libdb again (#111004)- rebuild- rebuilt- disable mutex locking- rebuilt- force use of assembly mutexes on %{ix86} to avoid dependency on libpthread- disable various language bindings when building the bundled DB library
- remove unpackaged files from the buildroot in %install
- don't install the compat version on arches where if we don't need one- automated rebuild- automated rebuild- rebuild in new environment- rebuild- whoops, __set_errno() is a glibc-internal symbol as well (#63373)- filter out dependency on glibc private symbols- don't use libc-internal symbols and interfaces- rebuild- rebuild- build using a bundled Berkeley DB with a unique name to avoid possible symbol
  collisions with binaries using different versions (mix multiple versions of
  any shared library in a sinfk00s@stCsof_lspv_lsvg_lynx_lzop_mac_applications_mac_files_for_application_madison_mail_mailboxes_main_complete_make_make-kpkg_man_match_math_mencal_menu_mere_message_mh_mime_types_mkshortcut_mkzsh_module-assistant_modutils_mondo_most_recent_file_mount_mozilla_mpc_mplayer_mt_mtools_mtr_multi_parts_mutt_my_accounts_mysql_utils_mysqldiff_ncftp_nedit_net_interfaces_netcat_netscape_newsgroups_next_label_next_tags_nice_nmap_normal_nothing_nslookup_object_classes_oldlist_open_options_options_set_options_unset_other_accounts_pack_parameter_parameters_patch_path_files_pbm_pdf_perforce_perl_perl_basepods_perl_modules_perldoc_php_physical_volumes_pick_variant_pids_pine_piuparts_pkgtool_ports_postfix_prcs_precommand_prefix_print_printenv_printers_prompt_ps_pscp_pspdf_psutils_putclip_python_quilt_raggle_rar_rcs_read_read_comp_redirect_regex_arguments_renice_requested_retrieve_cache_retrieve_mac_apps_rlogin_rpm_rsync_ruby_sablotron_samba_sccs_sched_screen_sed_sep_parts_service_services_set_set_command_setopt_setup_sh_signals_slrn_smit_socket_source_spamassassin_ssh_stat_store_cache_strip_stty_su_sub_commands_subscript_subversion_sudo_suffix_alias_files_sysctl_tags_tar_tar_archive_telnet_terminals_tex_texi_texinfo_tidy_tiff_tilde_tilde_files_time_zone_tin_tla_toolchain-source_trap_ttyctl_typeset_ulimit_uml_unace_unhash_uniq_unsetopt_update-alternatives_update-rc.d_urls_urpmi_urxvt_user_admin_user_at_host_users_users_on_valgrind_value_values_vared_vars_vnc_volume_groups_vorbis_vux_w3m_wait_wajig_wanted_webbrowser_wget_whereis_which_whois_wiggle_x_arguments_x_borderwidth_x_color_x_colormapid_x_cursor_x_display_x_extension_x_font_x_geometry_x_keysym_x_locale_x_modifier_x_name_x_resource_x_selection_timeout_x_title_x_utils_x_visual_x_window_xargs_xauth_xdvi_xfig_xloadimage_xmlsoft_xmodmap_xpdf_xset_xt_arguments_xt_session_id_xterm_xv_xwit_yodl_yp_zcat_zcompile_zdump_zed_zftp_zip_zle_zmodload_zmv_zpty_zstylealloptbackward-kill-word-matchbackward-word-matchbashcompinitcapitalize-word-matchcheckmailcolorscompauditcompdumpcompinitcompinstallcopy-earlier-wordcycle-completion-positionsdelete-whole-word-matchdown-case-word-matchdown-line-or-beginning-searchedit-command-lineforward-word-matchgetjobshardenhistory-pattern-searchhistory-search-endincargincremental-complete-wordinsert-filesis-at-leastkill-word-matchmatch-words-by-stylemerenarrow-to-regionnarrow-to-region-invisiblenslookuppick-web-browserpredict-onprompt_adam1_setupprompt_adam2_setupprompt_bart_setupprompt_bigfade_setupprompt_clint_setupprompt_elite2_setupprompt_elite_setupprompt_fade_setupprompt_fire_setupprompt_off_setupprompt_oliver_setupprompt_redhat_setupprompt_suse_setupprompt_walters_setupprompt_zefram_setuppromptinitpromptnlquote-and-complete-wordread-from-minibufferrelativereplace-stringrun-helpselect-word-stylesmart-insert-last-wordtcp_aliastcp_closetcp_commandtcp_expecttcp_fd_handlertcp_logtcp_opentcp_outputtcp_pointtcp_proxytcp_readtcp_renametcp_sendtcp_sesstcp_shoottcp_spamtcp_talktcp_waittetristranspose-words-matchup-case-word-matchup-line-or-beginning-searchurl-quote-magiczargszcalczedzed-set-file-namezfanonzfautocheckzfcdzfcd_matchzfcgetzfclosezfcputzfdirzffcachezfgcpzfgetzfget_matchzfgotozfherezfinitzflszfmarkzfopenzfparamszfpcpzfputzfrglobzfrtimezfsessionzfstatzftp_chpwdzftp_progresszftransferzftypezfugetzfuputzkbdzmvzrecompilezsh-mime-handlerzsh-mime-setupzstyle+site-functions/bin//etc//etc/skel//usr/lib64//usr/lib64/zsh//usr/lib64/zsh/4.2.6//usr/lib64/zsh/4.2.6/zsh//usr/lib64/zsh/4.2.6/zsh/net//usr/share/doc//usr/share/doc/zsh-4.2.6//usr/share/info//usr/share/man/man1//usr/share//usr/share/zsh//usr/share/zsh/4.2.6//usr/share/zsh/4.2.6/functions/-O2 -g -pipe -Wall -Wp,-D_FORTlx.@...69524f2eae3ca7898c4e26df490a7aaae71c49bd06de7d16759a8f6a2c986c139c971af63677402709b7c72738af0cfaf56dc56ef63c6a9e7db902d809f560f62435df501fc77c972683b6886192d226c94ab716297a5db227fab2db302ff90dcd0c1a5dd96850a66756693b055989d9e222a320d547ab3fa43a10edc08b89d5006e6596614b01ea3a5d4af1908de88c362da1af229e5b90b6f32fe771c6df9b1475f05deb0198e70019df9524934bf3e85ed8129ed876142e19e1f31c52d2a04c109f3725e71e3a22e777237c8be0306bbf7542cab777d0ba492d8f6d5772398739fdc3612c8dd12c9e6c7075cd5041d2eeaa0c33b09e868031c7b038b13e04d9126f1b7eee18a64567f4024b84b6a2401fa732ed9ef3ba4bd773635c4bb2b3b290044feff61e851df2c2c09a06da446a13d4d9662895418721cc8dda57777e5210790b4ac342829e70f1bc0d8d6a30d44a3ad76cd20aa6b9d2242af7f6740e40f3f1cef275a1b3bdfc1e605d86a74336454ca529f6b49f4b0ad77d470899e68e51336b8e9fb56899c45a70b921e773fb3958dd942389abaa0ac40702b66dc18ab29932443f8b9277ac0d5469ef033c89cfe4d2f4b81ea0525f64b18dd4d85f71088481fc5151c00d928c958b3cf6e1497a57bda2c4e52e34ccdc39692489d23da0c77395f0ce286ca59cc9024c08a1a2ee6836c584255f343ab9ac7317c8d1b152e72bc4224c89a54fc5e2961f9fc0f704dde0851582662cb317689496eb895e3be5f710ea9b7130e4b7b4a394ccd8a7225cf1ac7d34b2446669934cf4410dc25c81b06817a0462bce542aeb66dd9c94b10ba6166dd0364729f1ec1ce02865a602c1b812d0a012825ae5950252c9d22b7b7cd6c2f5c387ad505c3cc4cc26b3c062bc93b7fd18c59f4a7e0f205c0a25b3d2ffd50721ee5baf435d2b5a23fde7c267dbbd2aa4e4a8b946448a458f701a41f2448c684e8bc0212597ae2d1025f6da75425b1a9743a24d3ab4d47feed2bd4f4f360530ecad28d4edddfbcfc27103aaf175ad29b79637fe7910ad65939a80ff56a391a5c9ea893f02b2022f0acc2badbb861a2c88fb278c02334e64b050bdea81bb3105efb1ba4ec393aea8ef45119291ea3c1a3f85f41992900fd5f1f9150a4695532e2a7b5ad6b82edf8de081ac1ee3c62049e7858c62adef7a998e0eb790565c4c893e6518074d301e4ed8a1ac5846db2aab52b5a3b2be106af5435fb39efbf339ff46ea6e471ec0d2cf26499c301ed45c19747efd5940df02b08c56fefadb5cc9180404176e59b7441bdf824cad603c5914e3551e3eee610893054439148d77726ab094f19618352a366d14410f0610c11cf9bad0c502e2602cff0b142690fc64fe23fd493a808aebda8c55d1b756d5930e3763a1484b335f8aee752b55b0d1f11e47882c418ec3c6fcd2bf9dcc94460079eec35b5cf67203cccd8b49f0539bc2af69c3a2eed6f4e3aec23c1a39469ece93d3a7c468b447a899548f5c1d6aa1bb20ab0ad6fadc62e2a48a71508b0309cbda73876e960e3f86226af4d3933fe392e071c04cae140bd5a50ca98975f192b73c0cd8ea81c81298797d716096bd3b7108290aac6b5e77fc3c67650fc0220e936f7806d1d2ae1fe1cabaeebf8c538df01d976dc1c7dec6d47143dc7578918016175dfba2c8e52e7d01a0a4cc5d0c6932d458ef57355f683cbf226211a2676dc613647a551cc23448e868d83b8ebfee0bb60cfeba2c9caaaecec01a4e118df08dcf43ed9fe1d755aa480e07255966b4b6e6105d44df7be07265609c69b8da4d8c5c91a0be98d6bf2d41324095dcf1d24798f6c6bd9e237c2ee35436c88bcad3dab0b85821c505ccc06845a6edee24032fd034941b07155f070f2211141e7dea67bbf4106a385c085b8067ebd94014330d13c0fae2f8d79373eae0d00eb0a5ba2fde0f9e13954934036ee1159e31875bb3345332626ce1553b75b4cd9426e4b0494a1fa480ebcabb12ebd072838f8dc7674c5e31e906e7a832f875d6f0399b89436c08d88ac6ae0731d7f8db35ca14fc27ccb9bbf56e396e2b862de2ef21dd08282fa4054c5f697adf3c019a6171a0cca32332e2f419259b1d9ef091c359c58e585095b1b8e789d897485002ad2872adbdec4b4d5bf9d81f6fd7d24a76baea1395ad65af3cf56162a345f01d3cb1aa8edd32c80124d143c87e9975f73fa73a3a54fb8d130711e16c3250ad5cacce16379d7294bede44416f9fcc2e8000c1665687db3c03731813d3a4714326ffb8964921d5d64aade754243027dd54d69dd8b7aa7fcd703c3ed6a7b4e6fdc2215f97bc392680f964824987d4c9bcdbfe51c8b8d933087672b822ec1dcd114dbeeaf28f2cdd3ff44077743fa0b27580238ad3f0a9129f16004ec09998ca4fab27d6639c37f4e8b7e5ff9c43009e30c2b739163ab70e6d15989f81b12da56dbd0d715eaae70d1a39ad75e485848d8082af478f8e4943040fd8fcff99745489e73d418a19188d0d54715af67d5ca1868edbbb319d1a9b8804289aae4cb87bad9d48d51716109417ac95aba03421e569e5035c306b27ee9453e57fb52ba29c752146dc046a97fbdcbeb9e5fff6ae51e64b10aaea81324118eac79d1cd5f957f495759f83bd2e209c676e30ae7cb9a056db284f00f19c9eac803e65e6eef929ee0f1042c315caf6445e48d851ad6e08a7ce7464c38298e146eb34e02d135f91678b0ff13bc9a104e160c28f2218e148b6b9dbe90fbed617ddb651e0b595b798de935f5623kPR	@e10ec208f1fedcd1e399d833ce24b9e741e4daee701fa1c9a9aa9aa115ce18e5e8e8d70c2d17876f513661dbfde365f726655922314a3510d8f874bf3a958515716573d10c23c4c105bbc51d247c64515f290c7f9828e7e2e1677d41474096ab10c1ce7ad7b0ef237559baa1d8618acb37e2e0d4123a89e5b2b6fd7e3503e1b2e5530070d000d79cc22ab913b131bdf85afe041b22a9cd2c93abeb9dc9fedb2724665f0eb8cee3cbcf54642edff2ebe91eedcc429a8724b3ac7822d9d20770e222517f068fc13ec2b270fcda41f10d06743ab06915088648aaaa6538f67a89b7e3ac3e31292657ab85187eb24015f7f6958a058bda2160372d57e422dc15834ee86043c9f2a64db39e0f1ba78b36d4c43ecfff9a9f3427d3030d1500a8aacd4daa2d30fd47fed48d565960e561206108bd0c4cfee73563c98b72c2b60a3cc2b064842f4f736aa0877936ba4e17222b5300df138111f6679a3df84c939d251499bdd2e2e2a24894ef6d48b5a63d870e538caa74c9549259ebeea50989d4a3e36860822b1c40780d1e6123410089d28ab7a6878c911ee415f04c8d3427d2eed54c4a49390881372804b4f48565b6572199c64005251ae0004b0239f4a4fc29afc65e11ae215cabb175bd49ea51bf382fcf689ba8daa8f86790ec88a92d431040494f0041796ff92f546e24a3763a25aa8f5b900a6f872286e4471312a033ed246bff32d8af502aabc00c6b8ddb62f642fb8e84cf8ac582102df57c44a6b68150b2c1aa0914b75c41bad32fae37443f5f421bfe11dc5dd0b172d020c71077c9751793c5d5704d63f21af971d60d6bd9c4e05d3ebc68f92ce880355b1352005d76da5ea7681f66d7d9dadebe06c1fc73b45fab69198d61320d7da3b8860d33210e31078f6d44a8b7ebcb8aa6fd51ea22a28acc87515fd22785bbed6e731838bcd65abd3225fbcc9b6efe4732abf635f15d5418dc90d38eabf755006701d6901ad9480a822f3fbea1ada96816299877cdcf7c78d844d71df333dee1623a4b63e63e82e0e6ccd0244a2cfcbce2537c97f1bf9e6aa5f3e82f2a8e9f8fd895518a6f3b1d548e3c61636ff0ab398f5e2073cb1db6648df6c370557d90802e113602349372776e1fe6c66c99105a353bc6cd53222676756a54a88543e7d9385911086c33c3e683e72b1a3e56c1277ad6481e3cd70bf8d451632aa87a7ea97343c194efb88ad4f91c49d83691375b0161f71caccef7415223e0d04aa18f84cf59213e94dbfb4ceb8f284ef201852381ba24896b6ac05d858b5c22c0ccf9a8fddd4252b89ae14e7cba98b7f71cdb34f18c5d8a897bca1aa2f23eeba6c73036d0d1f1674d66e414636a5e982b5edcd943c6e7ee469f119d3952c2ca0ada35e90ec68b52ddb7f1b511793e2cba7b39ce27586894f7a83323afd16c84032c69450f64047275b98f36f2a505026404066db0add161226cf90a630511bfa56ae3bda77848b0227e032f3ed3fb93191fc61b961fdee970b365af0e4bca887c362aed435a9dad5827391cc84b821f06cb32357c24e058ddc097a6b1178521922f31a8492dee62e7a90e9a5a3170278206dd62dc5cea9ef750878e9a0e5b2aeda976e3cca642291d7db2aed267aae45b369bd7397e024f98773c0036a8bc211747a23a2b7b1f0de8910f5f13d8b132822155686b00e20082120e49f4bf1a9fb082c4df57cf16b4007f0c0298938797abe6d71d3007a42d1c9afb1b641a8d556cb363c0ea69efa70d73332f33e4596b75aaa34a6d029c6cb5b16983e90a6401cac58cb2f9014da5dbe9b5232954612e25fa0537ae94cf3b322601751e1aefaf19248ff84d3da6e5d501b99aad82e7e8e362a0d0b1824c47dfcefc8512e70b92f8a6e2d2950d2498aba7e6ed824e38664a83a51c50689135d29cc53fae08154e17b52c0821d664187805681af303ebc473504ddb0d58fc7f12fd04188cbf805dc1baaa0b92fe895493084df269e4c0e2469a407f83a1c12d2ba5a999c04f4d91559c9a660d72e9e871eaed2b4f3d1a0d8442c3c14258edb4416d4e0fb5cd57c5cdaebc83fd377ad582a7bbaf01950d66346280164fdb52d6e7f8800ab2a178a3be69fe4ea660c1b1e1707b17ac639742aabfc278cda9b552c51bbe8090249d6f037c004f5f8d217d0c2a6af67500a24650720ad494da775fba5efddd3df4e8d77d3c40e770c2c06c85f9e5aa07bd063db9f18c20acdb26fe3bd08a442308b6494fdc41f3b0ad5a89c3e7e7fdec0b0a6c1e83b095202abd23574cea5ff98813cbe6f62f2dc3a025d694126256d10631afc0ff28dcdf23127cf9986691fed31081160e4557fdb1e347f12e63252117765066afed36f06daee33ba00f0dd8ea3af2a5804c84e6873c497052dc91bda5c39b753d11056d1cf1cacc696120432b62808238bfc9c9c019fd1115eb9006064bd25d28a0611862487c0556ccb55b6d80b1519e449148aab10cc4c7f564d19beeb6abffc5a310a0b66f87eddb6279a75d00466ce6914be192dc55803880f384315b87ea33e524e8f38dc01b9995ff0928a6435052d18025656fab541018403a366f06949047e1e47450630c003470bbe892d6100b8662f8085d92a73c6c99fe7e0fe38598c051229206846f6d04aa82d0f6506c4f79177b5086e9b2dda556bcb464efbd8bae90867dc07eb0aa389255c9892a567f24a6ebc3cb1195bbe67a32fc868f85dd1e8a52f937bc6db139dc925c7e63bc9a42807babb691a4f0205e6fc7c5399cbddde91586682be4b7e40acad38fjp@fig additions (Don Dutile ) [442991]
- [xen] PV: add subsystem (Don Dutile ) [442991]
- [xen] PV: shared used header file changes (Don Dutile ) [442991]
- [xen] PV: shared use of xenbus, netfront, blkfront (Don Dutile ) [442991]
- [fs] backport zero_user_segments and friends (Eric Sandeen ) [449668]
- [fs] backport list_first_entry helper (Eric Sandeen ) [449668]
- [ia64] fix boot failure on ia64/sn2 (Luming Yu ) [451745]
- [ia64] move SAL_CACHE_FLUSH check later in boot (Luming Yu ) [451745]
- [ia64] use platform_send_ipi in check_sal_cache_flush (Luming Yu ) [451745]
- [xen] avoid dom0 hang when tearing down domains (Chris Lalancette ) [347161]
- [xen] ia64: SMP-unsafe with XENMEM_add_to_physmap on HVM (Tetsu Yamamoto ) [457137]- [crypto] IPsec memory leak (Vitaly Mayatskikh ) [455238]
- [ppc] edac: add support for Cell processor (Brad Peters ) [439507]
- [ppc] edac: add pre-req support for Cell processor (Brad Peters ) [439507]
- [scsi] DLPAR remove operation fails on LSI SCSI adapter (Brad Peters ) [457852]
- [net] bridge: eliminate delay on carrier up (Herbert Xu ) [453526]
-  [mm] tmpfs: restore missing clear_highpage (Eugene Teo ) [426083]{CVE-2007-6417}
- [scsi] aic94xx: update to 2.6.25 (Ed Pollard ) [439573]
- [fs] dio: lock refcount operations (Jeff Moyer ) [455750]
- [fs] vfs: fix lookup on deleted directory (Eugene Teo ) [457866]{CVE-2008-3275}
- [fs] jbd: fix races that lead to EIO for O_DIRECT (Brad Peters ) [446599]
- [fs] add percpu_counter_add & _sub (Eric Sandeen ) [443896]
- [xen] event channel lock and barrier (Markus Armbruster ) [457086]
- [ppc] adds DSCR support in sysfs (Brad Peters ) [439567]
- [ppc] oprofile: wrong cpu_type returned (Brad Peters ) [441539]
- [s390] utrace: PTRACE_POKEUSR_AREA corrupts ACR0 (Anton Arapov ) [431183]
- [pci] fix problems with msi interrupt management (Michal Schmidt ) [428696]
- [misc] fix wrong test in wait_task_stopped (Jerome Marchand ) [382211]
- [fs] ecryptfs: use page_alloc to get a page of memory (Eric Sandeen ) [457058]
- [misc]  serial: fix break handling for i82571 over LAN (Aristeu Rozanski ) [440018]
- [xen] blktap: expand for longer busids (Chris Lalancette ) [442723]
- [xen] fix blkfront to accept > 16 devices (Chris Lalancette ) [442723]
- [xen] expand SCSI majors in blkfront (Chris Lalancette ) [442077]
- [misc] core dump: remain dumpable (Jerome Marchand ) [437958]
- [fs] inotify: previous event should be last in list (Jeff Burke ) [453990]
- [block] Enhanced Partition Statistics: documentation (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: retain old stats (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: procfs (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: sysfs (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: cpqarray fix (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: cciss fix (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: aoe fix (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: update statistics (Jerome Marchand ) [224322]
- [block] Enhanced Partition Statistics: core statistics (Jerome Marchand ) [224322]
- [fs] add clear_nlink, drop_nlink (Eric Sandeen ) [443896]
- [fs] add buffer_submit_read and bh_uptodate_or_lock (Eric Sandeen ) [443896]
- [fs] noinline_for_stack attribute (Eric Sandeen ) [443896]
- [fs] i_version updates (Eric Sandeen ) [443896]
- [fs] add an ERR_CAST function (Eric Sandeen ) [443896]
- [fs] introduce is_owner_or_cap (Eric Sandeen ) [443896]
- [fs] add generic_find_next_le_bit (Eric Sandeen ) [443896]
- [fs] add le32_add_cpu and friends (Eric Sandeen ) [443896]
- [net] sctp: export needed data to implement RFC 3873 (Neil Horman ) [277111]
- [xen] x86: xenoprof enable additional perf counters (Markus Armbruster ) [426096]- [fs] dio: use kzalloc to zero out struct dio (Jeff Moyer ) [439918]
- [x86] hugetlb: inconsistent get_user_pages (x86 piece) (Brad Peters ) [456449]
- [fs] fix softlockups when repeatedly dropping caches (Bryn M. Reeves ) [444961k
@ad Esfahbod <besfahbo@redhat.com> 2.2.1-14Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-13Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-12Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-11Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-10Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-9Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-8Matthias Clasen <mclasen@redhat.com> - 2.2.1-7Jesse Keating <jkeating@redhat.com> - 2.2.1-6Jesse Keating <jkeating@redhat.com> - 2.2.1-5Matthias Clasen <mclasen@redhat.com> - 2.2.1-4.fc6Matthias Clasen  <mclasen@redhat.com> - 2.2.1-3Jesse Keating <jkeating@redhat.com> - 2.2.1-2.1Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-2Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-1Karsten Hopp <karsten@redhat.de> 2.1.10-6Jesse Keating <jkeating@redhat.com> - 2.1.10-5.2.1Jesse Keating <jkeating@redhat.com> - 2.1.10-5.2Jesse Keating <jkeating@redhat.com>Bill Nottingham  <notting@redhat.com> 2.1.10-5Matthias Clasen  <mclasen@redhat.com> 2.1.10-4Matthias Clasen  <mclasen@redhat.com> 2.1.10-3Jason Vas Dias <jvdias@redhat.com> 2.1.10-2Matthias Clasen  <mclasen@redhat.com> 2.1.10-1Kristian Høgsberg <krh@redhat.com> 2.1.9-4Karsten Hopp <karsten@redhat.de> 2.1.9-3David Zeuthen <davidz@redhat.com> - 2.1.9-2Owen Taylor <otaylor@redhat.com> - 2.1.9-1Elliot Lee <sopwith@redhat.com>Owen Taylor <otaylor@redhat.com> 2.1.7-4Mike A. Harris <mharris@redhat.com> 2.1.7-3Elliot Lee <sopwith@redhat.com> 2.1.7-2.1Elliot Lee <sopwith@redhat.com> 2.1.7-2Owen Taylor <otaylor@redhat.com> 2.1.7-1Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.1.4-4.1Owen Taylor <otaylor@redhat.com> 2.1.4-4.0Owen Taylor <otaylor@redhat.com> 2.1.4-3Owen Taylor <otaylor@redhat.com> 2.1.4-1Elliot Lee <sopwith@redhat.com>Jeremy Katz <katzj@redhat.com> 2.1.3-9Owen Taylor <otaylor@redhat.com>Elliot Lee <sopwith@redhat.com> 2.1.3-7Owen Taylor <otaylor@redhat.com>Tim Powers <timp@redhat.com>Owen Taylor <otaylor@redhat.com> 2.1.3-4Owen Taylor <otaylor@redhat.com> 2.1.3-3Mike A. Harris <mharris@redhat.com> 2.1.3-2Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.1.2-11Mike A. Harris <mharris@redhat.com> 2.1.2-10Tim Powers <timp@redhat.com> 2.1.2-8Owen Taylor <otaylor@redhat.com>Owen Taylor <otaylor@redhat.com>Owen Taylor <otaylor@redhat.com>Owen Taylor <otaylor@redhat.com>Owen Taylor <otaylor@redhat.com>Owen Taylor <otaylor@redhat.com>Owen Taylor <otaylor@redhat.com>Mike A. Harris <mharris@redhat.com> 2.1.1-2Owen Taylor <otaylor@redhat.com> 2.1.1-1Owen Taylor <otaylor@redhat.com>Tim Powers <timp@redhat.com>Mike A. Harris <mharris@redhat.com> 2.1.0-2Nalin Dahyabhai <nalin@redhat.com> 2.0.9-2Mike A. Harris <mharris@redhat.com> 2.0.9-1Mike A. Harris <mharris@redhat.com> 2.0.8-4Mike A. Harris <mharris@redhat.com> 2.0.8-3Mike A. Harris <mharris@redhat.com> 2.0.8-2Tim Powers <timp@redhat.com> 2.0.6-3Mike A. Harris <mharris@redhat.com> 2.0.6-2Mike A. Harris <mharris@redhat.com> 2.0.6-1Tim Powers <timp@redhat.com> 2.0.5-4Elliot Lee <sopwith@redhat.com> 2.0.5-3Bernhard Rosenkraenzer <bero@redhat.com> 2.0.5-2Mike A. Harris <mharris@redhat.com> 2.0.5-1Mike A. Harris <mharris@redhat.com> 2.0.4-2Mike A. Harris <mharris@redhat.com> 2.0.4-1Mike A. Harris <mharris@redhat.com> 2.0.3-7Mike A. Harris <mharris@redhat.com> 2.0.3-6Bernhard Rosenkraenzer <bero@redhat.com> 2.0.3-5Bernhard Rosenkraenzer <bero@redhat.com> 2.0.3-4Nalin Dahyabhai <nalin@redhat.com> 2.0.3-3Mike A. Harris <mharris@redhat.com> 2.0.3-2Mike A. Harris <mharris@redhat.com> 2.0.3-1Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Prospector <bugzilla@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbr\k0@751257bf9bfedaff6d6cc9944ad7fe4d57f2128a19dc4580d8110901168fd4c8db681e88ca30065ff0165203c3b5ce7b12a825fff04e8d5b0e5e03abfdcf0520b81c9e339ba6e402013056b577bdd6f7e0838f87d33e2cb555e20d7e9a6eba93e2769818789c99a0bc076bcb0f451e38c6c3d67f0b8dd3595a0a932e545c2e3a0482244dca0af6743aa1e1070a9abcbeaa210d1b497ed5b9d970d07b74a26036ee7696044317cbaaf69d707cf24a698c5496d4c954d6d5d4338171d623b5670249a841d25440eabfa6a1fdd848ea71ec6efad3620a219037133187b36263ab125fc7a3cf018520de77b2708516bab242ef82b5d045f1b9b4397d63728b79a790201190f3079388bd06ed0b15382e588e312b4499dfe059fd13b6dc7025745ec6765d9393a16545e8fdc12ba3e9f6422afdd437edef9cd6816c120c4f44d63310226f3b7ddb6978701b0b736ac31bd43a6987ce63b79de352cde373bb798ac47ce0e5aa079125c888ddf05d1a762c8fc5e5905184b854bd432595de5fdc263351a757a8e3eeaeba25d9833ac1d6d3d75f318f739305585fe2a4edd9e7672a2e3f04105ae8719cd83a4f912a5dfae1435bd688c547bef590d060956a082be75b236470a52df69306215666c5880969156fb6bbb18657f9d175094ab406b66657e619a61b783cc66f7533072f13bd968168ddd4fc273b1d93039c251e8890b6c5dd05ba875bc35c600c2c8c0dc25f70a75424b38af2ba5d1bf99dd77d3124acc5a6e4666027d291c067451934c20f7e9719f418833f0e7bdf2841125479b9409d95035c05ec963173e3fd8109c25e871d56f6751b3a8dbddef6ef333ee3ca31f1efae4a0d330b1293361e03334281b6e0c67953561cb0680ff0d18c24e973b72b565e9b5956b16845578fa21ea3ebd95ea021777c67b233974bc3602769aadff2b3830e57a3a07888cd3b0c6a70c625f2fe7fe216127fc5340128b608eb65dc8a449c4339e1747c46a0d362c07b69209ae9aec3a83b88d0d88fdec04801d639b06768f5b14c556f611747bcfaf8f51f9c16d12af002c846f8e629e30f042539af78c029fe65c9c9d73f29769fac05bbf79209e272526edb61ad9c429c681831ea5aeabadeefb742b262b1d79c258ec5df88d1c0d0edb4fc22f1587763d77d063f05403737d7c445ae55b2daede763a8c88eef6fbf701909a4b2bad1bfaa5803dc9eaf8b620546345b31f71aad54d25f1dc19937b025b941ecbbd78f703eefde566730940775c4c7bcf3bba9c03e49d615a42c7b4c7fea1f8dff57883ca32656ef4ed139ff5cd16f1c7c929d75459021b5f03ee205852cb240f69ac88a616fe5771045609ba0861271faa431eaf8382d4f11948c507768cb81b5be9dc1d66db62a4923c79bf934aee0be2098e36bf9cd902af3e12a691db7789ffe06e7e2de5462a8b2d13cf4d62cd4556ecdf3d246f905edb82fd269f3ef5eebf3ac8dcf0870925e60e7f8ae971ea906d92bc069c97cdd03a8d991197a9eea0932d9ad27fc2c7f97929b49c09dcdc84010ac0563babad9b859d520fec5cd1cf3cd90c630420105be5c46e1169d39d2d42758d6c5dfa3fe01f381facbff5e0c6e526cbe6506f30b06e5ce3bcbfe6180c14e76e8c96e671889510ee3033cfffeb6cf2e3c9c67cb94d618f152c9ccf8d23876e04a9d920cfd6c70b6433624c533c23b1936fbd1e939a82294dce2800f00844109324c46ca434b71409b196d76ac094ad1e2e362d163f5288e0e499a7c987678fe7ff9432bc4d4328b88e29c9617ef0d6d34f71df97c06d73c10b8f30cb8351683bcc1e96b3f2d91d59a95649541d0027c457d9770c5d4204b29f556a18f1451b49ece2d1a1a5748822732f766e94102ecd6a4b5ca431e2081a38fc128f0b17899bc6dd412d9231f7a91bb8a58e3f4f647651e7b68d84a48ee24901e369bd92eb3b1e377c4666697e066a7d731fc7dfe919738c2418466e178967a6b1a3da5d8505cb8b4d3bbcbadbe2ea2a194c6c625dacd2652c4d23b36c48ea88c18ff98dcc5218efbb7d15704e4fd04f2d210f458ce4326a56d7a30b49a3071c0b81ef8f8bdb04958f4d2f0f1cab91e5ecb02fb791194216229b8e859a3d621b47cda5c3c8167bf981fad4333f2d8809faaa4befd09b782574190fe30ea624db988691480ca5bb59688a6e8efd15c4f5b67b0729463d1667f9883894a93ed65990162ea4d19ac99e597a70836c39718ed2d1e96870aee933b0a3b203a6b7888d16921831670852f5d83cffedcf32e589c3fe14cb3bd0bd2057896332df7289d407cfb16f2d2db30af5e944032029837685688b8e1a42a3fc2025e9915dcca03a2e1c8184c7326966963e02524b4d03f3955bc715cd894af5d0d9b0f4e391735c5ffa1e4eabfc9d2bb995eed7559af923bb3a1b6ff80e9e73d6aa81d27a60f5aa4b7eb12a1552e5beea2d7ba86cf7707e818de146d6f6752d3d15ff8077dd6c5dd87b2d26a22651f6e527e2c66d0117f130d24486bad4c49fc9848d9d06b1116674a61d91e66a7eea2afbac9c05f3cf620e4506be6be436ebe355e79b2237d901d1ed0fdd71633f70fd95b42c7b35d0409424dce9d496806cef1b510d14db54e966c0fb57f4634ff9423029144a550a0f2087cd3110f82418e69356bfb73e9993a8b382c4c81a52043cde3ee1cfad79d95cc7ced946b9d6e68444207a8fe199012d56afc34e2de370e7bd724d9fb0eb481aff32578ae0060e7772f84c44883c030203d81e290979e2d9ccb67faa206469ch+@+*,_hooks.hatomic.hatomic64_32.hauxvec.hbitops.hboot.hbug.hbugs.hbyteorder.hcache.hcacheflush.hchecksum.hcpu.hcpufeature.hcputime.hcrash.hcurrent.hdebugreg.hdelay.hdesc.hdiv64.hdma-mapping.hdma.hdmi.hdwarf2.he820.hedac.helf.hemergency-restart.herrno.hfcntl.hfixmap.hfloppy.hfutex.hgenapic.hgeneric-hypervisor.hhardirq.hhighmem.hhpet.hhw_irq.hi387.hi8253.hi8259.hide.hintel_arch_perfmon.hio.hio_apic.hioctl.hioctls.hipc.hipcbuf.hirq.hirqflags.hist.hk8.hkdebug.hkexec.hkmap_types.hkprobes.hkvm_para.hldt.hlinkage.hlocal.hmach-bigsmpmach_apic.hmach_apicdef.hmach_ipi.hmach_mpspec.hmach-defaultapm.hbios_ebda.hdo_timer.hentry_arch.hio_ports.hirq_vectors.hirq_vectors_limits.hmach_apic.hmach_apicdef.hmach_ipi.hmach_mpparse.hmach_mpspec.hmach_reboot.hmach_time.hmach_timer.hmach_traps.hmach_wakecpu.hpci-functions.hsetup_arch.hsmpboot_hooks.hmach-es7000mach_apic.hmach_apicdef.hmach_ipi.hmach_mpparse.hmach_mpspec.hmach_wakecpu.hmach-genericirq_vectors_limits.hmach_apic.hmach_apicdef.hmach_ipi.hmach_mpparse.hmach_mpspec.hmach-numaqmach_apic.hmach_apicdef.hmach_ipi.hmach_mpparse.hmach_mpspec.hmach_wakecpu.hmach-summitirq_vectors_limits.hmach_apic.hmach_apicdef.hmach_ipi.hmach_mpparse.hmach_mpspec.hmach-viswscobalt.hdo_timer.hentry_arch.hirq_vectors.hlithium.hmach_apic.hmach_apicdef.hpiix4.hsetup_arch.hsmpboot_hooks.hmach-voyagerdo_timer.hentry_arch.hirq_vectors.hsetup_arch.hmach-xenasmagp.hdesc.hdma-mapping.hfixmap.hfloppy.hhighmem.hhw_irq.hhypercall.hhypervisor.hio.hirqflags.hkmap_types.hmaddr.hmmu.hmmu_context.hpage.hparam.hpci.hpgalloc.hpgtable-2level-defs.hpgtable-2level.hpgtable-3level-defs.hpgtable-3level.hpgtable.hprocessor.hptrace.hscatterlist.hsegment.hsetup.hsmp.hspinlock.hstacktrace.hswiotlb.hsynch_bitops.hsystem.htimer.htlbflush.hvga.hirq_vectors.hmach_traps.hsetup_arch.hmath_emu.hmc146818rtc.hmca.hmca_dma.hmce.hmman.hmmu.hmmu_context.hmmx.hmmzone.hmodule.hmpspec.hmpspec_def.hmsgbuf.hmsi.hmsr.hmtrr.hmutex.hnamei.hnmi.hnuma.hnumaq.hpage.hparam.hparport.hpci-direct.hpci.hpercpu.hpgalloc.hpgtable-2level-defs.hpgtable-2level.hpgtable-3level-defs.hpgtable-3level.hpgtable.hpoll.hposix_types.hprobe_roms.hprocessor.hptrace.hpvclock-abi.hpvclock.hresource.hrtc.hrwlock.hrwsem.hscatterlist.hseccomp.hsections.hsegment.hsemaphore.hsembuf.hserial.hsetup.hshmbuf.hshmparam.hsigcontext.hsiginfo.hsignal.hsmp.hsocket.hsockios.hsparsemem.hspinlock.hspinlock_types.hsrat.hstacktrace.hstat.hstatfs.hstring.hsuspend.hsystem.htermbits.htermios.htherm_throt.hthread_info.htimer.htimex.htlb.htlbflush.htopology.htracehook.htsc.htypes.huaccess.hucontext.hunaligned.hunistd.hunwind.huser.hvga.hvic.hvm86.hvmware.hvoyager.hxor.hasm-x86_648253pit.hKbuilda.out.hacpi.hagp.halternative-asm.ialternative.hamd_iommu.hamd_iommu_types.hapic.hapicdef.hasm-offsets.hatomic.hauxvec.hbitops.hboot.hbootsetup.hbug.hbugs.hbyteorder.hcache.hcacheflush.hcalgary.hcalling.hchecksum.hcompat.hconst.hcpu.hcpufeature.hcputime.hcrash.hcrc32c-hw.hcurrent.hdebugreg.hdelay.hdesc.hdiv64.hdma-mapping.hdma.hdmi.hdwarf2.he820.hedac.heficallwrap.helf.hemergency-restart.herrno.hfcntl.hfixmap.hfloppy.hfpu32.hfutex.hgenapic.hgeneric-hypervisor.hhardirq.hhpet.hhw_irq.hi387.hia32.hia32_unistd.hide.hidle.hinat.hinat_types.hinsn.hintel_arch_perfmon.hio.hio_apic.hioctl.hioctls.hipcbuf.hipi.hirq.hirqflags.hk8.hkdebug.hkexec.hkmap_types.hkprobes.hkvm_para.hldt.hlinkage.hlocal.hmach-xenasmagp.harch_hooks.hbootsetup.hdesc.hdma-mapping.hdmi.he820.hfixmap.hfloppy.hhw_irq.hhypercall.hhypervisor.hio.hirq.hirqflags.hmaddr.hmmu.hmmu_context.hmsr.hnmi.hpage.hparam.hpci.hpgalloc.hpgtable.hprocessor.hptrace.hsmp.hstacktrace.hsynch_bitops.hsystem.htimer.htlbflush.hvga.hxor.hirq_vectors.hmach_time.hmach_timer.jР @warding functions (Herbert Xu) [506630]
- [net] bridge: Move NULL mdb check into br_mdb_ip_get (Herbert Xu) [506630]
- [net] bridge: ensure br_multicast_query error path unlock (Herbert Xu) [506630]
- [net] bridge: Fix RCU race in br_multicast_stop (Herbert Xu) [506630]
- [net] bridge: Use RCU list primitive in __br_mdb_ip_get (Herbert Xu) [506630]
- [net] bridge: cleanup: remove unneed check (Herbert Xu) [506630]
- [net] bridge: depends on INET (Herbert Xu) [506630]
- [net] bridge: Make IGMP snooping depend upon BRIDGE. (Herbert Xu) [506630]
- [net] bridge: Add core IGMP snooping support (Herbert Xu) [506630]
- [net] bridge: Fix br_forward crash in promiscuous mode (Herbert Xu) [506630]
- [net] bridge: Split may_deliver/deliver_clone out (Herbert Xu) [506630]
- [net] bridge: Use BR_INPUT_SKB_CB on xmit path (Herbert Xu) [506630]
- [net] bridge: Avoid unnecessary clone on forward path (Herbert Xu) [506630]
- [net] bridge: Allow tail-call on br_pass_frame_up (Herbert Xu) [506630]
- [net] bridge: Do br_pass_frame_up after other ports (Herbert Xu) [506630]
- [net] bridge: Kill clone argument to br_flood_* (Herbert Xu) [506630]
- [net] Add netdev_alloc_skb_ip_align() helper (Herbert Xu) [506630]
- [fs] partitions: Validate map_count in Mac part tables (Danny Feng) [679284] {CVE-2011-1010}
- [fs] nfs: Only increment seqid for cmds seen by server (Sachin Prabhu) [651409]
- [scsi] ipr: fix a race on multiple configuration changes (Steve Best) [651429]
- [misc] vmware: increase apic_calibration_diff to 10000 (Prarit Bhargava) [665197]
- [net] tun: introduce tun_file (Michael S. Tsirkin) [672619]
- [virt] xen blktap: bump MAX_TAP_DEV from 100 to 256 (Laszlo Ersek) [452650]
- [fs] nfs: Too many GETATTR/ACCESS calls after direct I/O (Jeff Layton) [626974]
- [net] bonding: fix add/remove of slaves when master down (Flavio Leitner) [671238]
- [net] sctp: make sctp_ctl_sock_init try IPv4 if v6 fails (Jiri Pirko) [674175]
- [net] Fix netdev_run_todo dead-lock (Jiri Pirko) [679487]
- [net] niu: Fix races between up/down and get_stats (Jiri Pirko) [679407]
- [misc] introduce ACCESS_ONCE (Jiri Pirko) [679407]
- [x86] fix AMD family 0x15 guest boot issue on 64-bit host (Frank Arnold) [667234]
- [sound] alsa: cache mixer values on usb-audio devices (Don Zickus) [678074]
- [xen] prevent cross-vendor migration of HVM domains (Paolo Bonzini) [621916]
- [xen] new domctl to get 1 record from HVM save context (Michal Novotny) [674514]- [block] cciss: version bump (Tomas Henzl) [635143]
- [block] cciss: add option to enforce simple mode (Tomas Henzl) [635143]
- [block] cciss: patch to make kdump work in rhel5 (Tomas Henzl) [635143]
- [block] cciss: cleanup warnings (Tomas Henzl) [635143]
- [block] cciss: patch to support kdump on new controllers (Tomas Henzl) [635143]
- [block] cciss: factor out code to find max commands (Tomas Henzl) [635143]
- [block] cciss: split out cciss_defs (Tomas Henzl) [635143]
- [block] cciss: scsi tape updates (Tomas Henzl) [635143]
- [block] cciss: remove fail_all_cmds (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_passthru (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getdrivver (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getfirmver (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getbustypes (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getheartbeat (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_setnodename (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getnodename (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_setintinfo (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getintinfo (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_getpciinfo (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_reset_devices (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_find_cfg_addrs (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_wait_for_mode_change_ack (Tomas Henzl) [635143]
- [block] cciss: factor out cciss_p600_dma_prefetch_quirk (Tomas Henzl) [635143]
- [block] cciss: factor out ccil^.@..Hs?rd	(	LLPhlu|		
Tn
	r	
$

V(89:3>jBjFjGkHkxIkXkYlZl4[l@\lD]l^mbnSdnenfnknlntnuo`vo	wq0xqyr{r|rrrArA
s>shslsgshsCmodule-init-tools3.30.pre3.1.63.el5Kernel module management utilities.The modutils package includes various programs needed for automatic
loading and unloading of modules under 2.6 and later kernels, as well
as other module management programs. Device drivers and filesystems
are two examples of loaded and unloaded modules.RKbuilder17.centos.org
؂CentOS-5CentOSGPLSystem Environment/Kernellinuxx86_64# get rid of the old installations on upgrade
if [ -x /etc/rc.d/init.d/kerneld ] ; then
    /sbin/chkconfig --del kerneld
fi
if [ -f /etc/conf.modules -a ! -f /etc/modules.conf ] ; then
   mv -f /etc/conf.modules /etc/modules.conf
fi
if [ -f /etc/modules.conf -a ! -f /etc/modprobe.conf ] ; then
   echo "# Note: for use under 2.4, changes must also be made to modules.conf!" >/etc/modprobe.conf
   /sbin/generate-modprobe.conf --stdin < /etc/modules.conf >> /etc/modprobe.conf 2>/dev/null
   chmod 644 /etc/modprobe.conf
   echo "# Note: for use under 2.6, changes must also be made to modprobe.conf!" >> /etc/modules.conf
fitAh"xH6(+@;;
m
m_?
LA큤A큤큤RKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRK3a6a059e04b951923f6d83b7ed327e0ed41d8cd98f00b204e9800998ecf8427e4148adea745af5121963f6b731b6001307d67faa2743f1d41e2b658b2afa10225be9454ec05bdfcd237c4865cc40329590a0d712c7b0c9c0c25a92928c8e2793625729020629e9b602ec15559245f641764b04aeb1a531a68cf03e421b23771b5c6f3193b93394d21829391ae8fc7e17d1334ec53b21211c0d31ca5b3be7283e20659c824c06e66f38c2d42ceb0f50ddd3d0b988e46e394daef696f03cac24ed29efb975d496f1034e6801245d4796360a3436a94abc3f79022375bf40c8bca10a3436a94abc3f79022375bf40c8bca1471cfbeacfe2dd960c43f2c590d0b653471cfbeacfe2dd960c43f2c590d0b6531b31dd978f492c6e6c49372a12edecc4dd4f675fd559a7b47d9b859eda64879886e73a5a982376a22476a2702b9389f45fd8a2ad2d78d8d5422db3727799f7e972772b6bd79d23989de9993b76807740c985c620091ad4255b1ba0851fa5654f0186049bd28d8c46e14ef4d63fc9006fArootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmodule-init-tools-3.3-0.pre3.1.63.el5.src.rpmconfig(module-init-tools)modutilsmodule-init-tools@@@@@@@@@@@JJJ@@/bin/bash/bin/sh/bin/sh/sbin/chkconfigbinutilsconfig(module-init-tools)libc.so.6k0>	@>	?	=	han Ngo <than@redhat.com> 4.5-2Than Ngo <than@redhat.com> 4.5-1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Harald Hoyer <harald@redhat.de> 4.4-1Elliot Lee <sopwith@redhat.com>Than Ngo <than@redhat.com> 4.2-1Tim Powers <timp@redhat.com>Than Ngo <than@redhat.com> 3.9-9Elliot Lee <sopwith@redhat.com> 3.9-8Than Ngo <than@redhat.com> 3.9-7Than Ngo <than@redhat.com> 3.9-7Than Ngo <than@redhat.com> 3.9-6Than Ngo <than@redhat.com> 3.9-5.1Bernhard Rosenkraenzer <bero@redhat.com> 3.9-5Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 3.9-2Bernhard Rosenkraenzer <bero@redhat.com> 3.9-1Bernhard Rosenkraenzer <bero@redhat.com> 3.7-1Bernhard Rosenkraenzer <bero@redhat.com> 3.4-2Bernhard Rosenkraenzer <bero@redhat.com>- Fix back-tracking Unicode properties in non-UTF-8 mode (Resolves: #866520)- Fix pcregrep -Mv looping bug (Resolves: #859959)- Do not loop while compiling extended class when not in UTF-8 mode
  (Resolves: #669413)- Enable Unicode properties (Resolves: #457064)- Fix the names of the pacthes added in pcre-6.6-3:
  mv pcre-6.4-posix.diff pcre-6.6-CVE-2006-7225.patch
  mv pcre-6.4-fix1.patch pcre-6.6-CVE-2006-7226.patch
- Update pcre-6.6-CVE-2007-1659.patch
- Update pcre-6.6-CVE-2007-1660.patch
- Add pcre-6.6-CVE-2006-7230.patch
- Resolves: #380541- Use defined constants in pcre-6.6-CVE-2006-7224.patch
- Related: #373451- Improve the fix for CVE-2006-7224 by updating
  pcre-6.6-CVE-2006-7224.patch and adding pcre-6.4-fix1.patch
  and pcre-6.4-posix.diff
- Related: #373451- Resolves: #373451, CVE-2006-7224- Resolves: #315961, CVE-2007-1659, CVE-2007-1660- rebuild- update to 6.6
- fix multilib problem- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- update to 6.3- rebuild- don't print $libdir in 'pcre-config --libs' output- include LICENCE, AUTHORS in docdir
- run make check
- move %configure to %build- update to 5.0
- change License: BSD
- fix header location #64248- rebuilt- add the correct pcre license, #118781- update to 4.5- rebuilt- rebuilt- 4.4- rebuilt- update to 4.2- rebuilt- build with utf8, bug #81504- Really remove .la files- remove .la- Typo bug- Added missing so symlink- Fixed to build s390/s390x/x86_64- Fix #65009- automated rebuild- automated rebuild- rebuild- Update to 3.9- Update to 3.7- Move libpcre to /lib, grep uses it these days (#41104)- Move this to a separate package, used to be in kdesupport, but it's
  generally useful.../sbin/ldconfig/sbin/ldconfigbuilder17.centos.org 13806514451
1
11F11G11<<<11C/usr6.6-9.el5libpcre.so.0libpcre.so.0.0.1pcregreppcretestlibpcrecpp.so.0libpcrecpp.so.0.0.0libpcreposix.so.0libpcreposix.so.0.0.0pcre-6.6AUTHORSLICENCEpcregrep.1.gzpcretest.1.gz/lib//usr/bin//usr/lib//usr/share/doc//usr/share/doc/pcre-6.6//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII English textASCII textELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysymbolic link to `libpcre.so.0.0.1'symbolic link to `libpcrecpp.so.0.0.0'symbolic link to `libpcreposix.so.0.0.0'	()	
R
PRRRRRR	RRRRRRR	R
RRRRRRR	R
RRRPRRRR	R
RRR
RRRRRPRRRRR
Rl.@..CŠ?d		I48PT]d	m	0

"
#&*t.H.l1|111(28295d:WFAGdHtIXHYL\`]p^bdwe|fkltuvwx$y4{8 AaA
ĢŔgŘhŜCsendmail-cf8.13.810.el5_11The files needed to reconfigure Sendmail.This package includes the configuration files you need to generate the
sendmail.cf file distributed with the sendmail package. You will need
the sendmail-cf package if you ever need to reconfigure and rebuild
your sendmail.cf file.Ubuilder17.centos.orgrICentOS-5CentOSSendmailSystem Environment/Daemonslinuxx86_64S*P42		^e(
%h .9	ot-* 
:$:fS9?Qg,}v8.hO$+n?M%KE/bG
m/A<Q9_"W8Peed>[77
e}z5;rhM9A큤A큤$A큤A큤A큤A큤A큤A큤A큤A큤UUUUB><u6@86@6@6@6@6@	6@
7'Dz[6@
Dz[;ܐDz[6@
Dz[7Dz\<@5Dz\6@
Dz\6@
Dz\;:T6Dz\6@Dz\6@6@CDs6@6@6@6@6@6@UU9:6@
6@
6@
6@
Dz\6@6@6@6@6@7}DzY6@6@@99=9=7*<|	@5+C:-9D+(=D-`6=@o@2ѷ6@=9=8K6@=6@6@@(
BR:70Y6@8<0S98k<:0:2@5+C7>7*6@6@:i:!083O6@@;c;c=6=DzY6@U6@UUDǥ2UU<9Q;W&AE;W&;W&;W&;W&;W&:,>UE;DzZ;\N7.7.:1X`7!X7!X6@7!X84ݕ84ݖ84ݖBG7.7!XA7!X:.;'B>7!X7!X84޳7!X7!X7!X77!X98^9]<@88^7!X80W7!X7!X7!X7!X7!X7!X7!X77!X7(96@6@ 8^6@ >$w>$w>$w8-6@ 8^C+(DzZ6@!DzZ,,,,4c58aa960adb59466459ccddf607b161b45435c2804b5d7cbf8b3590eeff18d084eff126060b2a3c13973f43683d68da3cdedc45f837d350188a60c17c9bb9ad44242b33e0544b8fc9da973e4e98f148a10fef4085218eaec3b8254a97b556300618a21a671ee0ea6c75872196e2c0Pk@@D7?6d		H		-EKT	
y
ut	(
8
W9hW:UWF/G/H04I0X0Y0\0]1@^2Tb2d3_e3df3ik3kl3rt3u3v4T	w5x5y6P	{6t666A6A
767`7d7g7h7Crsync3.0.66.el5_11A program for synchronizing files over a networkRsync uses a reliable algorithm to bring remote and host files into
sync very quickly. Rsync is fast because it just sends the differences
in the files over the network instead of sending the complete
files. Rsync is often used as a very powerful mirroring process or
just as a more capable replacement for the rcp command. A technical
report which describes the rsync algorithm is included in this
package.T>Bbuilder17.centos.org
d#CentOS-5CentOSGPLv3+Applications/Internethttp://rsync.samba.org/linuxx86_64=XK	JPDLA"?9ST/eA큤A큤T$:KT>BT>BF%JfJfHJfAHcF8zHfqECފGN	CB,H	[BGL9#IrQ&DEB(6XT>@Jncd1f810af6843d776aafb5292ea764223a50f7215b390f32447c3aef1daf3d8ad32239bcb673463ab874e80d47fae50489bfe717e8db13dd5626033ffcda93b397078445fc399cb10ae45b09e2cb87aa43c5583be00f8aaed32345776ff6241f14eebb6370517d22d3af99d4fb3e194a8906022b9766bff75cdea38890698d721ec98c4ff5154168bea3e9b0eb66c60c4668ba2753f52294a63975ed265c64ecb6fae384f8ae374f6c35fc443f71a8e3f1303c2614ca7d75ea20a291ec9970a4dda6b13ea9173b875f637bf26fd3b2b4ba059c8287e7174286caa5a044fc0ae003b27e10d10ff45a7d3329b20c095aa475b342a6a5b605a2ba8e50f745c25f6df75008bf29fef04e8e28fa9fdf516deeda5e653d8d2985b34a1a9af15fb0bfbda848efb3b4f0bdaf45914707e5bcf752c22d679d67353dc5e6d51ecaf93d2116ec8cd120dfa29912f9a9c55d3bd6e70dff359ca2cc31b237c89f8fab7d84f1fb61cb1b23aa8297dbfe1422eb111d3110rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrsync-3.0.6-6.el5_11.src.rpmconfig(rsync)rsync@@@@@@@@JJ@config(rsync)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpopt.so.0()(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.6-6.el5_113.0.4-14.0-14.4.2.3T$`N0`M`M`MPk`MPk`DpD`D_`CC`C`BU`B`Bi`Bi`BLrB&7`B`A\AP`A"@q`@@`@z@cV`@-H?`?\?\?0(?0(?0(?0(?0(?.`>I`>I`>>>`>`>`>`>߽`>k>n\`>n\`>m
>m
>/`>(|=`=`=<f`<<<t`<U<Tx`<O2`;};];/`9b`9`99l`9B`8N8e8{88Z`7b`7`6k6`66z`5K5ا5'`4`3MbMichal Luscon <mluscon@redhat.com> - 3.0.6-6Jan KaluzjZ@tently shared (David S. Miller ) [233088] {CVE-2007-1592}
- [dlm] expose dlm_config_info fields in configfs (David Teigland ) [239040]
- [dlm] add config entry to enable log_debug (David Teigland ) [239040]
- [dlm] rename dlm_config_info fields (David Teigland ) [239040]
- [mm] NULL current->mm dereference in grab_swap_token causes oops (Jerome Marchand ) [231639]
- [net] Various NULL pointer dereferences in netfilter code (Thomas Graf ) [234287] {CVE-2007-1496}
- [net] IPv6 fragments bypass in nf_conntrack netfilter code (Thomas Graf ) [234288] {CVE-2007-1497}
- [net] disallow RH0 by default (Thomas Graf ) [238065] {CVE-2007-2242}
- [net] fib_semantics.c out of bounds check (Thomas Graf ) [236386]
- [misc] getcpu system call (luyu ) [233046]
- [ipc] bounds checking for shmmax (Anton Arapov ) [231168]
- [x86_64] GATT pages must be uncacheable (Chip Coldwell ) [238709]
- [gfs2] does a mutex_lock instead of a mutex_unlock (Josef Whiter ) [229376]
- [dm] failures when creating many snapshots (Milan Broz ) [211516 211525]
- [dm] kmirrord: deadlock when dirty log on mirror itself (Milan Broz ) [218068]
- [security] Supress SELinux printk for messages users don't care about (Eric Paris ) [229874]
- [serial] panic in check_modem_status on 8250 (Norm Murray ) [238394]
- [net] Fix user OOPS'able bug in FIB netlink (David S. Miller ) [237913]
- [misc] EFI: only warn on pre-1.00 version (Michal Schmidt ) [223282]
- [autofs4] fix race between mount and expire (Ian Kent ) [236875]
- [GFS2] gfs2_delete_inode: 13 (Steven Whitehouse ) [224480]
- [misc] k8temp (Florian La Roche ) [236205]- [x86_64] Calgary IOMMU cleanups and fixes (Konrad Rzeszutek ) [222035]
- [GFS2] lockdump support (Robert Peterson ) [228540]
- [net] kernel-headers: missing include of types.h (Neil Horman ) [233934]
- [mm] unmapping memory range disturbs page referenced state (Peter Zijlstra ) [232359]
- [IA64] Fix stack layout issues when using ulimit -s (Jarod Wilson ) [234576]
- [CIFS] Windows server bad domain name null terminator fix (Jeff Layton ) [224359]
- [x86_64] Fix misconfigured K8 north bridge (Bhavana Nagendra ) [236759]
- [gfs2] use log_error before LM_OUT_ERROR (David Teigland ) [234338]
- [dlm] fix mode munging (David Teigland ) [234086]
- [dlm] change lkid format (David Teigland ) [237126]
- [dlm] interface for purge (David Teigland ) [237125]
- [dlm] add orphan purging code (David Teigland ) [237125]
- [dlm] split create_message function (David Teigland ) [237125]
- [dlm] overlapping cancel and unlock (David Teigland ) [216113]
- [dlm] zero new user lvbs (David Teigland ) [237124]
- [PPC64] Handle Power6 partition modes (2) (Janice M. Girouard ) [228091]
- [ppc64] Handle Power6 partition modes (Janice M. Girouard ) [228091]
- [mm] oom kills current process on memoryless node. (Larry Woodman ) [222491]
- [x86] Tick Divider (Alan Cox ) [215403]
- [GFS2] hangs waiting for semaphore (Steven Whitehouse ) [217356]
- [GFS2] incorrect flushing of rgrps (Steven Whitehouse ) [230143]
- [GFS2] Clean up of glock code (Steven Whitehouse ) [235349]
- [net] IPsec: panic when large security contexts in ACQUIRE (James Morris ) [235475]
- [ppc64] Cell Platform Base kernel support (Janice M. Girouard ) [228099]
- [s390] fix dasd reservations (Chris Snook ) [230171]
- [x86] Fix invalid write to nmi MSR (Prarit Bhargava ) [221671]- [s390] crypto driver update (Jan Glauber ) [228049]
- [NMI] change watchdog timeout to 30 seconds (Larry Woodman ) [229563]
- [ppc64] allow vmsplice to work in 32-bit mode on ppc64 (Don Zickus ) [235184]
- [nfs] fix multiple dentries pointing to same directory inode (Steve Dickson ) [208862]
- [ipc] mqueue nested locking annotation (Eric Sandeen ) 
- [net] expand in-kernel socket api (Neil Horman ) [213287]
- [XEN] Better fix for netfront_tx_slot_available(). (Herbert Xu ) [224558]
- [fs] make static counters in new_inode and iunique be 32 bits (Jeff Layton ) [215356]
- [ppc64] remove BUG_ON() in hugetlb_get_unmapped_area() (Larry Woodman ) [222926]
- [dm] stalls on resume if noflush is used (Milan Broz ) [221330]
(lo0@00014-4Roman Rakus <rrakus@redhat.com> 1.0.14-3Roman Rakus <rrakus@redhat.com> 1.0.14-2Dave Lehman <dlehman@redhat.com> 1.0.14-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.13-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.12-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.11-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.10-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.9-3.el5_9Dave Lehman <dlehman@redhat.com> 1.0.9-2.el5_9Dave Lehman <dlehman@redhat.com> 1.0.9-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.8-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.7-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.6-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.5-3.el5_9Dave Lehman <dlehman@redhat.com> 1.0.5-2.el5_9Dave Lehman <dlehman@redhat.com> 1.0.5-1.el5_9Dave Lehman <dlehman@redhat.com> 1.0.4-2Dave Lehman <dlehman@redhat.com> 1.0.4-1Dave Lehman <dlehman@redhat.com> 1.0.3-1Dave Lehman <dlehman@redhat.com> 1.0.2-1Dave Lehman <dlehman@redhat.com> 1.0.1-3Dave Lehman <dlehman@redhat.com> 1.0.1-2Dave Lehman <dlehman@redhat.com> 1.0.1-1Dave Lehman <dlehman@redhat.com> 1.0.0-1- add support for ext4 dump locations
  Resolves: #767216- Fixed problem with parsing arguments if there is only crashkernel argument
  Resolves: #276811- Edit always default kernel settings
  Resolves: #276811- Display current settings at startup
  Resolves: #413151, #276811- require bitmap-fonts
  Resolves: rhbz#433858
- make sure translations containing format specifiers are found
  Resolves: rhbz#314341- handle kdump service start/stop
  Resolves: rhbz#239324
- only suggest reboot if memory reservation altered
  Related: rhbz#239324
- preserve unknown config options
  Resolves: rhbz#253603
- add 'halt' default action
  Related: rhbz#253603- prompt user for a PAE kernel for 32-bit xen with >4G memory (Jarod Wilson)
  Resolves: rhbz#284851- add support for xen (patch from Jarod Wilson)
  Resolves: #243191- handle ia64 bootloader correctly
  Resolves: #220231
- align memory requirements with documented system limits
  Resolves: #228711- only present ext2 and ext3 as filesystem type choices (#220223)- make "Edit Location" button translatable (#216596, again)- more translations
- use file: URIs instead of local: (#218878)- more translations (#216596)- rework memory constraints for increased flexibility (#215990)
- improve consistency WRT freezing/thawing of widgets (#215991)
- update translations (#216596)- add ChangeLog and COPYING as docs- use %{_sysconfdir} instead of /etc in specfile- remove #!/usr/bin/python from system-config-kdump.py (for rpmlint)- fix install make target to specify modes where needed
- remove unnecessary %preun
- various specfile fixes to appease rpmlint- fix path to icon in glade file- all location types now in combo box (no text entry for type)
- preserve comment lines from kdump.conf instead of writing config header
- add hicolor icon from Diana Fong- rework UI to only allow one location
- minor spec file cleanup- add support for "core_collector" and "path" handlers
- give choices of "ssh" and "nfs" instead of "net"
- validate results of edit location dialog
- add choice of "none" to default actions
- remove "ifc" support since it's gone from kexec-tools
- update kdump config file header
- fix a couple of strings that weren't getting translated- Fix parsing of "crashkernel=..." string from /proc/cmdline- convert crashkernel values to ints when parsing- Fix bugs in writeDumpConfig and writeBootloaderConfig
- Fix handling of pre-existing "ifc" and "default" directives
- Always leave network interface checkbutton sensitive
- Various minor fixes- Initial build/bin/sh/bin/shbuilder10.centos.org 1367920278


k@ew subpackage freetype-demos, added demos to build
- Disabled ftdump, ftlint in utils package favoring the newer utils in
  demos package.- Updated source to 2.0.4
- Added freetype demo's back into src.rpm, but not building yet.- Changed package to use {findlang} macro to fix bug (#50676)- Changed freetype-devel to group Development/Libraries (#47625)- Fix up FT1 headers to please Qt 3.0.0 beta 2- Add ft2build.h to -devel package, since it's included by all other
  freetype headers, the package is useless without it- Change "Requires: freetype = name/ver" to "freetype = version/release",
  and move the requirements to the subpackages.- Added "Requires: freetype = name/ver"- Updated to Freetype 2.0.3, minor specfile tweaks.
- Freetype2 docs are is in a separate tarball now. Integrated it.
- Built in new environment.- rebuild for C++ exception handling on ia64- Build ttmkfdir with -O0, workaround for Bug #24253- libtool is used to build libttf, so use libtool to link ttmkfdir with it
- fixup a paths for a couple of missing docs- Update ttmkfdir- Update to 2.0.1 and 1.4
- Mark locale files as such- automatic rebuild- move .la file to devel pkg
- FHS paths- revert spaces patch, fix up some foundry names to match X ones- add defattr, ftmetric, ftsbit, ftstrtto per bug #9174- fix description and summary- make ttmkfdir replace spaces in family names with underscores (#7613)- 1.3.1
- handle RPM_OPT_FLAGS- fix a path for ttmkfdir Makefile- newer ttmkfdir that works better, moved ttmkfdir to /usr/bin from /usr/sbin
- freetype utilities moved to subpkg, X dependency removed from main pkg
- libttf.so symlink moved to devel pkg- strip binaries- auto rebuild in the new build environment (release 5)- fixed the %doc file list- Injected new description and group.- added ttmkfdir- update to 1.2- call libtoolize to sanitize config.sub and get ARM support
- dispoze of the patch (not necessary anymore)- post/postun sections for ldconfig action.- initial RPM, includes normal and development packages./sbin/ldconfig/sbin/ldconfig/bin/shbuilder10.centos.org 1359662169uvw2.2.1-32.el5_9.1libfreetype.so.6libfreetype.so.6.3.10freetype-2.2.1ChangeLogREADME/usr/lib//usr/share/doc//usr/share/doc/freetype-2.2.1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII English textELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysymbolic link to `libfreetype.so.6.3.10'R	PRRRRRRR?k#(a*ֈ?Q
YGV(	}z+1M/`f%%5
o,L߈?Q
YGV(6=KU:C-)A
A".S5ײ=N86b44107a4438d5f37be7bdc508cf5eee015240d\=	\<w be cancellable
    both in libpthread.so and libc.so
  - removed @@GLIBC_2.3.2 cancellation wrappers- update from CVS
  - replace __libc_lock_needed@GOTOFF(%ebx) with
    %gs:offsetof(tcbhead_t, multiple_threads)
  - start of new NPTL cancellation wrappers- update from CVS
- use inline locks in malloc- update from CVS
  - support LD_ASSUME_KERNEL=2.2.5 in statically linked programs- update from CVS
- rebuilt with gcc-3.2.1-2- update from CVS
- non-nptl --with-tls --without-__thread FLOATING_STACKS libpthread
  should work now
- faster libc locking when using nptl
- add OUTPUT_FORMAT to linker scripts
- fix x86_64 sendfile (#79111)- update from CVS
  - RUSCII support (#78906)
- for nptl builds add BuildRequires
- fix byteswap.h for non-gcc (#77689)
- add nptl-devel package- update from CVS
  - make --enable-kernel=2.2.5 --with-tls --without-__thread
    ld.so load nptl and other --with-__thread libs
- disable nptl by default for now- update from CVS
- restructured redhat/Makefile and spec, so that src.rpm k@,@@,?,onsole-auth patch
- rebuild- Update to upstream CVS build
- Added console-auth patch- Workaround added to fix gcc-3.4 bug on ia64- require new Pyrex version and see if it builds this time- rebuild with updated Pyrex (0.9.2.1)- rebuilt- Moved dbus-viewer, dbus-monitor and dbus-glib-tool 
  into the dbus-glib package so that the main dbus
  package does not depend on glib (Bug #125285)- rebuilt- added my Python patch
- took out the qt build requires
- added a gtk+ build requires- Changed build requirement to version 0.9-3 of Pyrex
  to fix problem with builing on x86_64- update to upstream 0.21
- removed dbus-0.20-varargs.patch patch (fixed upstream)- added a dbus-python package to generate python bindings
- added Pyrex build dependacy- rebuilt- fix dbus error functions on x86-64 (#116324)
- add prereq (#112027)- rebuilt- Conflict with cups prior to configuration file change, so that the
  %postun service condrestart works.- rebuild in fc2, cups now updated- update to upstream 0.20- hmm, dbus doesn't support uids in the config file. fix.- put uid instead of username in the config file, to keep things working with name change- make subpackages require the specific release, not just version, of base package- change system user "messagebus" -> "dbus" to be under 8 chars- see if removing qt subpackage for now will get us through the build system,
  qt bindings not useful yet anyway- 0.13 fixes a little security oops- break the tiny dbus-launch that depends on X into separate package
  so a CUPS server doesn't need X installed- rebuilt- 0.11.91 cvs snap properly merges system.d- build a cvs snap with a few more fixes- fix a crash that was breaking cups- 0.11- use rc.d/init.d not init.d, bug #90192
- include the new man pages- 0.9
- export QTDIR explicitly
- re-enable qt, the problem was most likely D-BUS configure- update from CVS with a fix to set uid after gid- new cvs snap that actually forks to background and changes 
  user it's running as and so forth
- create our system user in pre- fix for "make check" test that required a home directory- disable qt for now because beehive hates me
- pull a slightly newer cvs snap that creates socket directory
- cat the make check log after make check fails- initial build/sbin/ldconfig/sbin/ldconfigdbusbuilder17.centos.org 138066451211B1.1.2-21.el51.1.2-3libdbus-1.so.3libdbus-1.so.3.4.0/lib/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysymbolic link to `libdbus-1.so.3.4.0'R
PRRRRRRR	R
RRR?p`H1,_k1j,?RKBGV(h<[D("\,4
w_3Ǿ>i[*rI?RKBGV(".džsEnt:0]O+p aǪ4f44fd0f0812ec02861d9c0d2936c729f13f34dab\=\<6-<|~WP[r&rrwDDyNd5DW-KIⱲ6o;J
7
p!2NyB%Ѱmz6
_oMUvS-)a#~^d㡛wf"u?	?ÃGKon	rD&bÍ#֬#J"1O]˰0tmMM
k4WP=-KO*+!ƀETa_QjZ	~ll({5S4?~Spל*1~ьzö?|yγ:,_~ע@yOͦ,/E/U&	&t	F	Ft	䘚~g&&FFq*Ϩ,5Tw4&FW4Gǒ89]̬$ivyD,
O0dFZtVn^

+RG^5OExyȣr3d9_MZkmKkFo
Yo
Z
ZNtvu_)~ϋk0`@8991388e130c55dfe31b8a759006afc68a69bf2e880fd0a31d1a77c314f63196b21b05c12e26c55333d6aa98efff726f549f7b3058dbda7d769aa0ee7722b96d2a4c929ce9971cb980771d201d18b7c5c4fe6815eb5f98845155ce5c63290264332bad36ca0060e989e8239703ec2d1a82c71ad3e56e452066ddc81524557f44ed9f726c79fc30d34b4ea382e70319ba2c7f0c7a0296c4d40a3da00395eabd964a200eef5e63ab239deed539fcc50437cef83d1c3c66f8469e15ffce2c7570b0f834c701764bdb7e000c5b60954d0659802ca9f26bab0985ee54510f2c9a6715a26dbfd1e1d2a332237f6f6eba888080594e2ca9886ea38542154f53be8bf28ea211b41e246e06aa6f70d890e8b10ae30d2091375bdb4448297cb87e1c96644965c2944556a9e07d738a91a1e573148e86a1db27e027c3020f56f8d681c9093fc2d2fd07e61121de751e8b089dcad2772c24e45ef25c35c3b5b383f0db7826702f0a87658da8b58faa7e64157956fc803698c3956e4fff0166eb5406654c3cd6c9b517ce7b2aa3d9712c9dced6c8eb2e84891ee6599747385736fe10dc64c314503337e4e7ecda037afc5a72ccf9bef877469607a6fc526040d33514956850e8f314427d1559369d6d8925dd645f904e1383a5e268561a1072aaad48cc04448b5afa203def2ab23ab5d0a8ed516d38613b3993c3672fc2c92a555911b5980b993c0cfba8fad7658103fdbef5a4e781ca5dbb17df72c9189d817a128da3a91943062aae3dcc53cb75e6280c0c0cdf5a92fad74e82523ed5dffd093f8db2f1e85c6928b49f491a191a815c5828756c61f3db58422b5b6acf64f5fda57ea87d1057e0ef64c4ad1b711bf909160ca6da5dd373211b57aa11a20506c3e24769caecbdddad998035b515fce061c350e8e23b7e0b382e561fe2a276e49e1a6cebce18fd26453ac184fc410fe9595530b17e335d532d347cce6f1ab5eae598b9b94f60ada0f9bd828f7447c931d47802e80b46e116ef3ed4d1b0413f790b4d57334be1f39d1c48d3ff293b45c6b2da44f6325c87935fb3533e267628aee072967ed75138edadfedfd849956e5f46a52287d1353adbbe701e43dc252439ae6d2f21716b663cc36a7b06a6ed7b70b254d7e285d9d3e7056fb528115b74b4dcdcbac5feb2383f3a12566a66634a5ed39964379a4686d49f025cf699cc258ddf5e8e85e6d12c095ab4c781a26b842d33732b6e4ec85a40b136566895c9205b720ae6a2241d6101533fb1aa481a343fe177bb5a00207c0cb4e7b4f07422deff3a7cf6e538648e75e1bae02a7cdf90e24d5b64a4cafdeb44f094fc82d0b5207d3fa3d81982261ee631ddcd9f70fa3bd35e6af17f0766ffb9f43ac8511ad7acc8af802e784c27f48e21d8aa5c14458827208aa74ef6773499fb169f56cd3ae95eb0810873676a61c3e279056e674b3a7a122fd4a986aa8cec97de877f5232b03bbda26aaf1fce7d1d4f1ab78b1060c6a0aaa6713af4a7c50821230c2a794b08f8360f6261a907cebc918d17f59791428bf1e62c82ae51157663b58ab92d9206b4d2f626eb0539a0b4b892b3498523119a8ac5cd61d4c019f4c5edb7661e63e9fbc2aa8ba08d14b4ae9c64b293b7001a260a29a2a9683a27701e06cabf79d0f0fb03e3c31359bf71da0f539040206d7f7a76d76a33880fd6eda744bf33c9467ea73302a4960a25d60ace76457298055057466f2e9ab0baefb27f3a83c0e32895f6071e299ff5ac44ff0eb5b1c9cab5b2982f695288dfd0a1db055b50d22d4f4b59da7aaa1b2ff19b99aa8b3d1f42bc21c3bcd575f9237a180d3b896687fb3c56fcb32f78fe830e7f7f39429e22ae0e677ef7df42ae7276a12e4a0b295e9e22e9e6acad314ae6cdea5eef01dac8e4d8749b047b6128ff53daa25de6ed212ae046a887fdc8a4248cc5894bad646a8aee9ce5d8fc371fcac7574b6a07c7b0468a8ddacd5fc95c27cb8e0f579837b326e764e6cb74aa5d94ef43f3e72cd635bbb2e39c88fcd3b8970bbd801f03cc4c13c43d9668af3af37163a66a71be78d8f8350d1708eff3408594c71dbe52755917c90c316bc5a6bf02b9a04f1866d2ad895d5ecaee6c1e1d49cfd145de2b7f57ae35291eadf3ec154e12f5f578097e478add1852816749171226c91672dde695098748084a436b99530ac4972c83b0aa27f7331c937964ec05ec7ee6180207bae8597af5718b84da333762765e5666543d46230427237c8adaa294b0ff7c020bc91334cd7a2f9a5dbbe2eb58a9258b00def9428861f5b6a4de2148df1c626e011d49c7501bcd2e33139959a3c3f8e68b41ca318890f70d33af953b61f73d3bfdfa40e4a42a0d8c84ee1b30ae937808fd03b2db970a37968a147bd0aa7a2f87a81acdd4d873533e906dcd6821552a70d2c1a311c0bfb3b85632341fc3f2d6efbfa7bb815601437d206a225e82af3ff3604d202920bdd0c0de8921e667a0662ce829315fbbeb90141ab100d2b12960597f5939e19f958dc022637eb0ecc0dbf2dcfae7674e146d5c5eebbb3cb8fc05ddac809417cef6237e9d2bb7aba9cba33d0c27a43b517388e56e234ec2d216e028914b2b1f33e4aff09faa54c65cbfce3243d1d83cd634698bf1cd306c158a01581c035f3c412751170669435450708b225edf06b678a2bc0e5c6861770bc04556b56f45728b85c6f2ed334f6d5297bb54dd10114b46fca46feb04dfcdbbb302580f4f618cad5bb4c9a728b2c652935c5201a9b8404f609a7f7d910337602e6254aj
(@is) [210637]
- Xen: Properly close block frontend on non-existant file (Glauber de Oliveira Costa ) [218037]
- SHPCHP driver doesn't work if the system was under heavy load (Kei Tokunaga ) [215561]
- SHPCHP driver doesn't work in poll mode (Kei Tokunaga) [211679]
- pciehp: free_irq called twice (Kei Tokunaga ) [216940]
- pciehp: pci_disable_msi() called to early (Kei Tokunaga ) [216939]
- pciehp: parallel hotplug operations cause kernel panic (Kei Tokunaga ) [216935]
- pciehp: info messages are confusing (Kei Tokunaga ) [216932]
- pciehp: Trying to enable already enabled slot disables the slot (Kei Tokunaga ) [216930]
- CacheFiles: cachefiles_write_page() shouldn't indicate error twice (David Howells) [204570]
- IPMI - allow multiple Baseboard Management Centers (Konrad Rzeszutek ) [212572]
- nfs - set correct mode during create operation (Peter Staubach ) [215011]
- Xen: blkback: Fix potential grant entry leaks on error (Rik van Riel ) [218355]
- Xen: blkback: Copy shared data before verification (Rik van Riel) [217994]
- revert: Xen: fix SMP HVM guest timer irq delivery (Rik van Riel ) [213138]- Adding in a kabi_whitelist (Jon Masters) [218402]
- Xen: AMD-V HVM fix for Windows hibernate (Bhavana Nagendra ) [217367]
- Xen: fix SMP HVM guest timer irq delivery (Rik van Riel ) [213138]
- NetLabel: bring current with upstream: cleanup/future work (Eric Paris ) [218097]
- NetLabel: bring current with upstream: performance (Eric Paris ) [218097]
- NetLabel: bring current with upstream: bugs (Eric Paris ) [218097]
- TG3 support Broadcom 5756M/5756ME  Controller (John Feeney ) [213204]
- tg3: BCM5752M crippled after reset (Andy Gospodarek ) [215765]
- sata ata_piix map values (Geoff Gustafson ) [204684]
- e1000: Reset all functions after a PCI error (Janice M. Girouard) [211694]
- prevent /proc/meminfo's HugePages_Rsvd from going negative. (Larry Woodman ) [217910]
- netlabel: disallow editing of ip options on packets with cipso options (Eric Paris ) [213062]
- xen netback: Fix wrap to zero in transmit credit scheduler. (Herbert Xu ) [217574]
- megaraid initialization fix for kdump (Jun'ichi Nick Nomura ) [208451]
- HFS: return error code in case of error (Eric Paris ) [217009]
- Xen: fix 2TB overflow in virtual disk driver (Rik van Riel ) [216556]
- e1000: fix garbled e1000 stats (Neil Horman ) [213939]
- dlm: use recovery seq number to discard old replies (David Teigland ) [215596]
- dlm: resend lock during recovery if master not ready (David Teigland ) [215596]
- dlm: check for incompatible protocol version (David Teigland ) [215596]
- NetLabel: Do not send audit messages if audit is off (Eric Paris ) [216244]
- selinux: give correct response to get_peercon() calls (Eric Paris ) [215006]
- SELinux: Fix oops with non-mls policies (Eric Paris ) [214397]
- Xen blkback: Fix first_sect check. (Rik van Riel ) [217995]
- allow the highest frequency if bios think so. (Dave Jones ) [218106]
- AGP corruption fixes. (Dave Jones ) [218107]- Xen: fix vcpu hotplug statistics (Rik van Riel ) [209534]
- DLPAR and Hotplug not enabled (Janice M. Girouard ) [207732]
- Reduce iommu page size to 4K on 64K page PPC systems (Janice M. Girouard) [212097]
- e1000: add (2) device ids (Bruce Allan) [184864]
- power6: illegal instruction errors during install (Janice M. Girouard) [216972]
- update_flash is broken across PPC (Janice M. Girouard) [214690]
- write failure on swapout could corrupt data (Peter Zijlstra) [216194]
- IBM veth panic when buffer rolls over (Janice M. Girouard ) [214486]
- Make the x86_64 boot gdt limit exact (Steven Rostedt ) [214736]
- Xen: make netfront device permanent (Glauber de Oliveira Costa ) [216249]
- lockdep: fix ide/proc interaction (Peter Zijlstra ) [210678]
- Xen: fix iSCSI root oops on x86_64 xen domU (Rik van Riel ) [215581]
- Fix flowi clobbering (Chris Lalancette ) [216944]
- Enable netpoll/netconsole for ibmveth (Neil Horman ) [211246]
- dlm: fix size of STATUS_REPLY message (David Teigland ) [215430]
- dlm: fix add_requestqueue checking nodes list (David Teigland ) [214475]
- dlm:Nj0 @r race with reset_task (John Feeney) [796825]
- [net] tg3: Schedule at most one tg3_reset_task run (John Feeney) [796825]
- [net] tg3: Obtain PCI function number from device (John Feeney) [796825]
- [net] tg3: Fix irq alloc error cleanup path (John Feeney) [796825]
- [net] tg3: Fix APE mutex init and use (John Feeney) [796825]
- [net] tg3: add tx_dropped counter (John Feeney) [796825]
- [net] tg3: Remove zero assignments of ethtool_ringparam fields (John Feeney) [796825]
- [net] tg3: Code movement (John Feeney) [796825]
- [net] tg3: Eliminate tg3_write_sig_post_reset() prototype (John Feeney) [796825]
- [net] tg3: Eliminate tg3_stop_fw() prototype (John Feeney) [796825]
- [net] tg3: Add ability to turn off 1shot MSI (John Feeney) [796825]
- [net] tg3: Remove tp->rx_offset term when unneeded (John Feeney) [796825]
- [net] tg3: Fix missed MSI workaround (John Feeney) [796825]
- [net] tg3: Check all adv bits when checking config (John Feeney) [796825]
- [net] tg3: Update version to 3.120 (John Feeney) [796825]
- [net] tg3: Add external loopback support to selftest (John Feeney) [796825]
- [net] add external loopback test in ethtool self test (John Feeney) [796825]
- [net] tg3: Restructure tg3_test_loopback (John Feeney) [796825]
- [net] tg3: Pull phy int lpbk setup into separate func (John Feeney) [796825]
- [net] tg3: Consilidate MAC loopback code (John Feeney) [796825]
- [net] tg3: Remove dead code (John Feeney) [796825]
- [net] tg3: Fix NVRAM selftest failures for 5720 devs (John Feeney) [796825]
- [net] tg3: Fix RSS indirection table distribution (John Feeney) [796825]
- [net] tg3: remove unnecessary read of PCI_CAP_ID_EXP (John Feeney) [796825]
- [net] tg3: Migrate phy preprocessor defs to system defs (John Feeney) [796825]
- [net] tg3: Show flowctrl settings through get_settings() (John Feeney) [796825]
- [net] tg3: Add more selfboot formats to NVRAM selftest (John Feeney) [796825]
- [net] tg3: Remove 4G_DMA_BNDRY_BUG flag (John Feeney) [796825]
- [net] tg3: Remove 40BIT_DMA_LIMIT_BUG (John Feeney) [796825]
- [net] tg3: remove interrupt.h inclusion from netdevice.h (John Feeney) [796825]
- [net] Add Fujitsu 1000base-SX PCI ID to tg3 (John Feeney) [796825]
- [scsi] qla4xxx: v5.02.04.04.05.09-d0. (Chad Dupuis) [796715]
- [scsi] qla4xxx: Minidump cleanup patch from upstream (Chad Dupuis) [796715]
- [scsi] qla4xxx: Add change_queue_depth API support (Chad Dupuis) [796715]
- [scsi] qla4xxx: Diff between fw hung triggered and normal reset. (Chad Dupuis) [796715]
- [scsi] qla4xxx: Disable gen pause frames with fw hang on ISP82xx (Chad Dupuis) [796715]
- [scsi] qla4xxx: 82XX: Temperature monitoring for P3P core. (Chad Dupuis) [796715]
- [scsi] qla4xxx: Rem force poll logic during disabling interrupts (Chad Dupuis) [796715]
- [scsi] qla4xxx: Correct early completion of pending mbox. (Chad Dupuis) [796715]
- [scsi] qla4xxx: Proper detection of fw abort err code for ISP82xx (Chad Dupuis) [796715]
- [virt] use dev_printk when possible (Prarit Bhargava) [839278]
- [virt] io_apic: only scan the root bus in early PCI quirks (Prarit Bhargava) [839278]
- [virt] x86/PCI: use dev_printk when possible (Prarit Bhargava) [839278]
- [virt] irq and pci_ids for Intel DH89xxCC DeviceIDs (Prarit Bhargava) [839278]
- [virt] hwmon: enable i5k_amb driver to get memory resource (Prarit Bhargava) [839278]
- [x86_64] Add missing CPU feature flags for AMD Bulldozer (Prarit Bhargava) [839278]
- [fs] dlm: fix slow rsb search in dir recovery (David Teigland) [753244]
- [fs] autofs: propogate LOOKUP_DIRECTORY flag only for last comp (Ian Kent) [814418]
- [x86] get irq for hpet timer (Prarit Bhargava) [834188]
- [virt] Make on_a_virt_guest() global (Prarit Bhargava) [834188]
- [net] virtio: Set correct gso->hdr_len (Thomas Graf) [748332]
- [net] ipv6: udp: Support hardware checksumming (Thomas Graf) [748332]
- [net] udpv6: Fix gso_size setting in ip6_ufo_append_data (Thomas Graf) [748332]
- [fs] ext4: properly dirty split extent nodes (Eric Sandeen) [839770]- [fs] nfs: Don't allow multiple mounts on same mntpnt with -o noac (Sachk-@--	 Fixed init script to exit properly (bz 471574)- Fixed a few bugs in BANNED_INTERRUPTS (bz 479459)
- updated irqbalance man page (bz 479586)- Fix man page to explain irqbalance exits (bz 442897)- Fixed a few typos and brought over LSB fixed (bz 242477)- Fixed initscript bug (bz 432977)- Bumping rev number for rebuild- Fixed cpu parsing bugs (bz 311341)
- Added docs/config for irqbalance env. vars. (bzs 339551 339571 339581)- Add -fPIE to build to enable execshield support- Migration point to RHEL5 (bz 219035)- Fixing typos in spec file (bz 219301)- Updating to version 0.55- Update irqbalance to new version released at www.irqbalance.org- Add ability to set default affinity mask (bz 211148)- fix up irqbalance to detect multicore (not ht) (bz 211183)- bumping up MAX_INTERRUPTS to support xen kernels
- rediffing patch1 and patch3 to remove fuzz- Making oneshot mean oneshot always (bz 211178)- Fix subsystem locking- rebuilt with latest binutils to pick up 64K -z commonpagesize on ppc*
  (#203001)
- Remove hack to use cvs checkin ID as release as it doesn't follow
  packaging guidelines- Change license to GPL in version 0.13- identify a bunch more classes.- rebuild- Further lazy rebalancing tweaks.- Don't rebalance IRQs where no interrupts have occured.- Build for ppc[64] too.- rebuild.- rebuilt for new gcj- rebuilt- Rebuild with gcc4- Build as pie, also -D_FORTIFY_SOURCE=2- Add missing Obsoletes: kernel-utils.- Start irqbalance in runlevel 2 too. (#102064)- Initial packaging, based on kernel-utils./bin/sh/bin/shkernel-utils/bin/shbuilder17.centos.org 1435327882;;;; 2:0.55-16.el5_11irqbalanceirqbalanceirqbalanceirqbalance.1.gz/etc/rc.d/init.d//etc/sysconfig//usr/sbin//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII English textBourne shell script text executableELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippeddirectoryRRRR	R
RRR?Pq²p$!?UGV(>Nb7;\Ag@t߽}a<iҰ%|ufF?UGV(g~C6a+J݄j\׊/\J"Xwpà4fe37121ca3d43ef8e7a33c83bea575696826b5d\=+|\<gnome-modem.png	fapplications-development.png:`:mklost+found.8.gzdr.ca-bundle.crtJ^libslang.so.2.0.6>itype_traits.h&	tty_ioctl.4.gz&Fecvt.3p.gz&nearbyintl.3.gz`&getchar.3.gz`&obsolete.2.gz.convert.html&mvwinnstr.3x.gz&--form_field_info.3x.gz	K		I	def_helper.hppKIinserter_algorithm.hpp2K22I2filtered_graph.hpp
KK

II
function.hppKIxml_wiarchive.hpp&CTraitGen.lcl	unix2dos.1.gz&director_h.swgJallegrocl.swgrules.netlibg2c.aP	Pcc_hash_max_collision_resize_trigger_imp.hpp!SystemConfig-More.directory))vdbe.html~ddjam.vimart_rect_svp.h~os_390.txt.gz~insert.txt.gzqbluez-libs-3.7`Gfree.1.gz:=gstring.h:3gqueue.h:#giochannel.hGetopt::Long.3pm.gziiB::C.3pm.gzperlmachten.podgmtime.pmMANIFEST.SKIP&"F"hp150$bashref.htmlARMSCII-8.gzYY'Blanc-SablonalAfrica l 0@000m> 2.6.2-2Alex Larsson <alexl@redhat.com> 2.6.2-1Christopher Aillon <caillon@redhat.com> 2.6.1-1Elliot Lee <sopwith@redhat.com>Alex Larsson <alexl@redhat.com> 2.6.0-1Alex Larsson <alexl@redhat.com> 2.5.90-2Alex Larsson <alexl@redhat.com> 2.5.90-1Elliot Lee <sopwith@redhat.com>Alexander Larsson <alexl@redhat.com> 2.5.6-1Elliot Lee <sopwith@redhat.com>Alexander Larsson <alexl@redhat.com> 2.5.3-1Tim Waugh <twaugh@redhat.com> 2.4.0-2Alexander Larsson <alexl@redhat.com> 2.4.0-1Alexander Larsson <alexl@redhat.com> 2.3.6-2Alexander Larsson <alexl@redhat.com> 2.3.6-1Alexander Larsson <alexl@redhat.com> 2.2.3-1.EAlexander Larsson <alexl@redhat.com> 2.2.3-1Elliot Lee <sopwith@redhat.com>Jeremy Katz <katzj@redhat.com> 2.2.0-3Tim Powers <timp@redhat.com>Alexander Larsson <alexl@redhat.com> 2.2.0-1Alexander Larsson <alexl@redhat.com> 2.1.4-1Tim Powers <timp@redhat.com>Alexander Larsson <alexl@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Tim Powers <timp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Tim Powers <timp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Havoc Pennington <hp@redhat.com>Owen Taylor <otaylor@redhat.com>Alex Larsson <alexl@redhat.com>- Rebuild against xulrunner
- Added ESR 17 xulrunner patch- rebuild against xulrunner
- fixed xulrunner patch- rebuild against xulrunner- rebuild against xulrunner- rebuild against xulrunner
- added xulrunner fix
- added -fno-strict-aliasing to build flags- rebuild against xulrunner- rebuild against xulrunner- rebuild against xulrunner- rebuild against xulrunner- rebuild against xulrunner- rebuild against xulrunner- backported some gecko 1.9 fixes from yelp-2.21 and- Rebuild against newer gecko- Rebuild against newer gecko- Rebuild against newer gecko- Don't crash on search strings containing only ':' (#216797)- Backport some fixes from 2.16.2 (216797, 216798, 216804,
  216806, 216800)- Rebuild against newer gecko- Improve the whatis parser (#213704)- Silence %pre (#213838)- Fix some crashes (#212888)- Fix scripts according to the packaging guidelines- Dynamically load and use beagle- Update to latest version from fc6- Rebuild- Actually apply the Pango patch- Update to 2.16.0- Use Pango- Rebuild- Update to 2.15.91- disable mono- Update to 2.15.5
- Rebuild against firefox-devel- Go back to 2.15.2, since gecko 1.8 is still missing- rebuild- Update to 2.15.3- Update to 2.15.2- Bump mozilla_version from 1.7.12 to 1.7.13 (closes #190880).- Add build requirements: startup-notification-devel
                          libgnomeprintui22-devel
                          libXt-devel- Update to 2.15.1- Update to 2.14.1- Update to 2.14.0- Update to 2.13.6- Turn on info and man support for test3- Update to 2.13.5- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Update to 2.13.4- Update to 2.13.3
- enable search- Disable search, since it doesn't compile against 
  current beagle- Patched to include DocBook mimetype in desktop file, and added preun and post
  hooks to update-desktop-database (#175880)
- Patched to ensure that Yelp recognizes that it can handle the mimetype of the
  documentation as reported by gnomevfs (also #175880)- Update to 2.13.2- rebuilt- Update to 2.13.1- build on ppc64 now that we have mozilla there again- Rebuild- Include the category General|Linux|Distributions|Other on the
  title page- Fix a double-free bug- Update to 2.12.1- Update to 2.12.0- rebuild- rebuild- Rebuild against newer mozilla- Rebuild against newer mozilla- Newer upstream version- Update to 2.10.0 (bug 157752, 146862).- Depend on mozilla 1.7.8- Disable man support
- Disable info support
- Don't try to install schemas during install (bug 154035)- Depend on mozilla 1.7.7- rebuilt- Depend on mozilla 1.7.6- Rebuild againstIkP&@@ cursor and fixed fonts.- xorg-x11-server-1.1.1-always-mouse-thyself.patch: Fix the check to look
  for mouse/void drivers in the running layout, as opposed to the config file,
  so as not to synthesize two mouse devices.- xorg-x11-server-1.1.1-infer-virtual.patch: Be slightly more paranoid about
  setting line pitch, and rescan the mode list after pruning to re-validate
  the estimated virtual size.- Update xorg-x11-server-1.1.1-offscreen-pixmaps.patch to evict pixmap
  when GLX_EXT_texture_from_pixmap is first used.- Drop xorg-x11-server-1.1.0-gl-include-inferiors.patch now that
  compiz can uses the composite overlay window.- Update xorg-x11-server-1.1.1-offscreen-pixmaps.patch to log transitions.
- Update xorg-x11-server-1.1.0-tfp-damage.patch to always bind to
  GL_TEXTURE_RECTANGLE_ARB target.- xorg-x11-server-1.1.1-pci-paranoia.patch: In xf86MatchPciInstances, fail
  gracefully if xf86PciVideoInfo is NULL (like, on Xen).- Add xorg-x11-server-1.1.1-aiglx-happy-vt-switch.patch to fix VT
  switching (and suspend/resume) when using AIGLX. (#199692, fdo #7916).
- Bump mesa source and libGL BuildRequires.
- Update mesa-6.5.1 patch to work with 6.5.1 rc1 (slang_version_syn.h
  renamed to slang_pp_version_syn.h).- xorg-x11-server-1.1.1-infer-virtual.patch: Only flag modes as preferred
  if the EDID block says to.
- xorg-x11-server-1.1.1-mode-sort-kung-fu.patch: Enforce a sort order on
  modes during lookup: builtin before driver before userdef before other,
  and preferred modes within a class before others in that class.- xorg-x11-server-1.1.1-edid-quirks-list.patch: Don't set an arbitrary
  pixclock limit if the monitor didn't claim to have one.- Add Tilman Sauerbecks patch to fix AIGLX DRI locking.- xorg-x11-server-1.1.1-xvfb-composite-crash.patch: Fix Xvfb's -render flag
  to also disable the Composite extension.
- xorg-x11-server-1.1.1-mesa-6.5.1.patch: Update build system to account for
  Mesa 6.5.1 snapshots.
- xorg-x11-server-1.1.0-edid-mode-injection-2.patch: Add all available
  standard timings from EDID rather than just the first five.- xorg-x11-server-1.1.1-edid-quirks-list.patch: Unbreak.- xorg-x11-server-1.1.1-xkb-in-xnest.patch: Added. (#193431)- xorg-x11-server-1.1.1-infer-virtual.patch: When no modes or virtual size
  are given in the config file, attempt to pick a sensible one by examining
  the EDID modes and physical geometry.  Also generally make the server
  aware of driver-provided modes.
- xorg-x11-server-1.1.1-edid-quirks-list.patch: Redo, since the property I was
  checking for is both fairly common and fairly predictable.- xorg-x11-server-1.1.1-fix-default-mouse-device-yet-again.patch: Added.- xorg-x11-server-1.1.1-always-mouse-thyself.patch: If we lack a mouse
  device in the config, and the user hasn't asked for any void devices,
  synthesize a mouse section.  (#200347)
- xorg-x11-server-1.1.1-edid-quirks-list.patch: Better formatting.- xorg-x11-server-1.1.1-builderstring.patch: Enable the builder info
  string at configure time;
- ... and use it to print the package name and version.
- xorg-x11-server-1.1.1-defaultdepth-24.patch: Set default depth to 24.
- xorg-x11-server-1.1.1-edid-quirks-list.patch: Add EDID quirks list as
  an experiment; needs a better solution though.- Update offscreen-pixmaps patch to migrate pixmaps when the compiz
  selection is taken.- Build for fc5 aiglx repo.- Add xorg-x11-server-1.1.1-offscreen-pixmaps.patch to default
  XaaNoOffscreenPixmaps to false, for now.- xorg-x11-server-1.1.0-edid-mode-injection-2.patch: Off-by-one error in
  range storage.- xorg-x11-server-1.1.0-edid-mode-injection-2.patch: Allow HorizSync and
  VertRefresh to be overridden independently.- xorg-x11-server-1.1.1-revert-xkb-change.patch: Revert change to xkb that
  broke XkbGetKeyboard().- Add conflicts for ABI incompatible version of xorg-x11-drv-i810 and
  xorg-x11-drv-ati.- Comment out the 848x480 modes from the extramodes patch.  Any panel that
  wants it should be doing EDID injection by now, and it screws up
  autoconfig by _just_ fitjx04@453arn on nfs mounts with same SB but diff opts (Eric Paris ) [466701]- [alsa] hda: improve init for ALC262_HP_BPC model (Jaroslav Kysela ) [473949]
- [ppc] LPAR hang on multipath device with FCS v2 (AMEET M. PARANJAPE ) [498927]
- [fs] nfsd: fix setting the nfsv4 acls (Steve Dickson ) [403021]
- [scsi] fnic: compile on x86 too (mchristi@redhat.com ) [501112]
- [net] avoid extra wakeups in wait_for_packet (Neil Horman ) [497897]
- [x86] xen: fix local denial of service (Chris Lalancette ) [500951]
- [scsi] ibmvfc: wait on adapter init before starting scan (AMEET M. PARANJAPE ) [501560]
- [net] bnx2x: update to 1.48.105 (Stanislaw Gruszka ) [475481]
- [xen] add Credit Scheduler Fairness and hard virt (Justin M. Forbes ) [432700]
- [xen] deadlock between libvirt and xentop (Miroslav Rezanina ) [499013]
- [xen] sched: remove printk introduced with hard virt (Justin M. Forbes ) [501475]- [kabi] add cmirror symbols to kABI (Jon Masters ) [500745]
- Revert: [sched] accurate task runtime accounting (Linda Wang ) [297731] {CVE-2007-3719}
- [alsa] hda: add missing comma in ad1884_slave_vols (Jeff Burke ) [500626]
- [x86] remove xtime_lock from time_cpufreq_notifier (Prarit Bhargava ) [501178]
- [fs] cifs: fix pointer and checks in cifs_follow_symlink (Jeff Layton ) [496577] {CVE-2009-1633}
- [fs] ext4: corruption fixes (Eric Sandeen ) [501082]
- [lockdep] don't omit lock_set_subclass (Aristeu Rozanski ) [462248]
- [ppc] cell: make ptcal more reliable (AMEET M. PARANJAPE ) [501356]
- [x86] include asm-x86_64 in i686-devel package (Don Zickus ) [491775]
- [misc] compile: add -fwrapv to gcc CFLAGS (Don Zickus ) [491266]
- [trace] mm: eliminate extra mm tracepoint overhead (Larry Woodman ) [501013]
- [dlm] use more NOFS allocation (Abhijith Das ) [460218]
- [dlm] connect to nodes earlier (Abhijith Das ) [460218]
- [wireless] mac80211: freeze when ath5k IF brought down (Michal Schmidt ) [499999]
- [audit] watch: fix removal of AUDIT_DIR rule on rmdir (Alexander Viro ) [501321]
- [trace] sunrpc: adding trace points to status routines v2 (Steve Dickson ) [499008]
- [misc] random: make get_random_int more random (Amerigo Wang ) [499776]
- [md] retry immediate in 2 seconds (Jesse Larrew ) [489582]
- [scsi] retry for NOT_READY condition (Jesse Larrew ) [489582]
- [md] handle multiple paths in pg_init (Jesse Larrew ) [489582]
- [scsi] fix compilation error (Jesse Larrew ) [489582]
- [scsi] add LSI storage IDs (Jesse Larrew ) [489582]
- [scsi] handle quiescence in progress (Jesse Larrew ) [489582]
- [scsi] retry IO on unit attention (Jesse Larrew ) [489582]
- [scsi] handle unit attention in mode select (Jesse Larrew ) [489582]
- [scsi] make the path state active by default (Jesse Larrew ) [471426]
- [scsi] Retry mode select in rdac device handler (Jesse Larrew ) [489582]- [acpi] updated dock driver for RHEL-5.4 (Matthew Garrett ) [485181]
- [infiniband] ib_core: use weak ordering for user memory (AMEET M. PARANJAPE ) [501004]
- [mm] fork-o_direct-race v3 (aarcange@redhat.com ) [471613]
- [nfs] make nfsv4recoverydir proc file readable (Evan McNabb ) [499840]
- [pci] remove pci-stub driver from -xen kernels (Don Dutile ) [500568]
- [pci] IOMMU phys_addr cleanup (Don Dutile ) [500901]
- [pci] missed fix to pci_find_upstream_pcie_bridge (Don Dutile ) [500901]
- [misc] IOMMU MSI header cleanup (Don Dutile ) [500901]
- [scsi] megaraid: update megasas to 4.08-RH1 (Tomas Henzl ) [475574]
- [fs] nfs: fix an f_mode/f_flags confusion in write.c (Jeff Layton ) [490181]
- [fs] cifs: renaming don't try to unlink negative dentry (Jeff Layton ) [500839]
- [fs] cifs: fix error handling in parse_DFS_referrals (Jeff Layton ) [496577] {CVE-2009-1633}
- [scsi] aacraid: update to 1.1.5-2461 (Rob Evers ) [475559]
- [md] dm raid45: don't clear the suspend flag on recovery (Heinz Mauelshagen ) [499406]
- [net] cxgb3: update driver for RHEL-5.4 (mchristi@redhat.com ) [439518]
- [scsi] add cxgb3i iscsi driver (mchristi@redhat.com ) [439518]
- [scsi] port upstream offload code to RHEL-5.4 (mchristi@redhat.com ) [439518]
- [scsi] force retry ofkp1.@1.0.2.ly to local FS (Resolves: #589523)
- Remove xqmstats(8) manual as we do not provide the executable
  (Resolves: #589578)
- Add rpc.rquotad(8) symlink to rquotad(8) manual (Resolves: #595729)- fix rpc.rquotad to find proper exported nfs file system
  (bz #244577)- comment out examples in sample quotatab(bz #435995)
- Used #include <sys/quota.h> instead of <linux/quota.h> in
  quotactl manpage(bz #431978)
- always resolve numeric usernames(bz #234558)- Added range checking on -p flag (bz 205145)
- Error message prints garbage characters (bz 201226)- rebuild- fix 192826 - quota config files should not be overwritten- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Upgraded to version 3.13 (bz# 171245)- change the "Requires: kernel" into a "Conflicts:"- add URL (bz# 131862)- Fixed typos in warnquota.conf patch 
  (bz# 82250 and bz# 83974)- upgraded to 3.12- rebuilt- rebuilt- add -pie support
- update to 3.10- upgraded to 3.0.9
- added quota-3.09-root_sbindir.patch- Rebuild- rebuilt- rebuilt for 7.3 errata- rebuilt- add buildprereq on tcp_wrappers- rebuilt- rebuild on all arches- added --with-ext2direct=no to fix #73244
  without this users with UID's > 65535 will not
  be able to exist on a quota enabled FS- Man page change. #60108- Bah, I'd dropped epoch from the spec file but seems
  we need this if you want to upgrade as the epoch
  number has precedence over the version/release
  numbers.- Lets stop the makefile from stripping the
  binaries as thats rpms job (apparently)- Ditched the 3.01-pre9 src base for 3.06
  Rebuilt without any patchs

============================================================- automated rebuild- automated rebuild- IfArch the badkernelinclude patch for ppc-only.
- Update to 3.03- Make #include of kernel header file work on non-x86- require new initscripts- fixed bug #52075 (problem with ext2 labels)
- backup data files off by default in quotacheck, optional backup flag added
- fix bug where giving a bad directory or device would cause 
  quotaon/quotacheck to simulate "-a" behaviour
- if a device name (i.e /dev/hda1) is passed, look up the corresponding mount
  point- return an error code in more cases in convertquota- 3.01pre9- more cleanups on 3.01pre8- 3.01 version, everything has changed again. :(- Bump release + rebuild.- use rpc.rquotad from here again (#33738)- enable ALT_FORMAT for edquota- I broke passing devices on the cmd line.  Fixed.- quota 3.00 is required by recent kernel 2.4 changes
- no warnquota included this time, not yet ported
- quite a bit of work on quotacheck to make is backwards compatible
- we will likely go back to "quota 2.00" as these projects merge...- use "rm -f" instead of only "rm"- fix quotacheck man page for -a option (#26380)- 2.00 final, rolls in pretty much all our patches. :)
- fix reporting of in use dquot entries from quotastats
- change repquota man page to fix documentation of -v (#10330)
- include warnquota.conf- fix ia64 build- add LABEL=foo support (#16390).- remote NFS quotas with different blocksize converted incorrectly (#11932).- automatic rebuild- FHS packaging.- apply patch5 (H.J. Lu)- fix description
- man pages are compressed- quota 2.00 series
- removed unnecessary patches- fix man page FUD (#4369).- changes to allow non-root users to build too (Makefile patch, %attr)- fix for sparc64 quotas (#2147)- auto rebuild in the new build environment (release 5)- don't install rpc.rquotad - we will use the one from the knfsd package
  instead- merge ultrapenguin 1.1.9 changes.- translations modified for de, fr, tr- removed patch for mntent- updated to quota 1.66- builds rquotad
- installs rpc.rquotad.8 symlink- removed /usr/include/rpcsvc/* from filelist
- uses a buildroot and %attr- built against glibc- Moved /usr/sbin/quota to /usr/bin/quotabuilder10.centos.org 1357710417k-@---ild against db-4.2.42.- update to 8.12.10- add security patches for CAN-2003-0694 and CAN-2003-0681- move debug information from sendmail into debuginfo rpm
- on %post make sure /etc/aliases.db and /etc/mail/*.db is correctly
  owned by root
- do not set confTRUSTED_USER to smmsp in sendmail-redhat.mc- run "make -C /etc/mail" (maybe generating new sendmail.cf, then newaliases
- added $SENDMAIL_OPTARG that could be set by /etc/sysconfig/sendmail #99224- adjust rpm license tag to say "Sendmail"- enable pie only for a few archs
- enable full optims for s390 again, compiler seems to be fixed- apply patch from Ulrich Drepper to support -pie- rebuilt- make init script more robust #91879- sendmail-cf requires m4, #90513- move Sendmail.conf from /usr/lib/sasl to /usr/lib/sasl2 and change the
  default pwcheck method to "saslauthd"- configure to use libsasl2 instead of libsasl to avoid linking with both
  (we also link to libldap, which now uses libsasl2)
- link with -ldb instead of -ldb-4.0 on all releases after RHL 7.3 instead
  of just 7.3 (all versions of db4-devel thereafter are expected to provide
  the right linking setup)- add a "umask 022" before building the *.cf files in /etc/mail/Makefile- mark /etc/mail/Makefile as config(noreplace) #87688
- mark /etc/pam.d/smtp as config(noreplace) #87731- update to 8.12.9- call make with the target "all" #86005
- add start/stop/restart as Makefile targets
- add another security patch- add correct db4-devel requirements for newer releases
- completely re-do many ifdef code in the spec-file
- fix some issues building for older RHL releases- rebuilt- rebuilt- update to 8.12.8- rebuilt- rebuilt- add a confTRUSTED_USER line into sendmail.mc, submit.mc is already ok
- add patch from sendmail.org for cf/m4/proto.m4- do not reject all numeric login names if hesiod support is
  compiled in.   #80060
- remove reference to non-existing man-pages #74552- sendmail-8.12.7-etrn.patch from Jos Vos <jos@xos.nl>
- submit.mc: enable "use_ct_file" by default  #80519
- add _FFR_MILTER_ROOT_UNSAFE  #78223- update to 8.12.7
- hack to make lib64 version work
- downgrade s390 optims to make it compile- add openssl-devel as a build-time requirement
- preprocess the config file to add the right version of %{_lib}
- add kerberos -I and -L flags to build configuration, needed for newer
  versions of libssl- always have a queue run interval for sm-msp-queue   #81424
- Jos Vos suggests adding another variable for sm-client queue-run- add the following changes from Adrian Havill <havill@redhat.com>
  to our default sendmail.mc file:
	- added commented-out-by-default common AUTH/SSL examples
	- updated m4 example and rpm reference
	- added more comment documentation
	- add commented out confAUTO_REBUILD example
	- improve description about MASQUERADE_AS- add to submit.mc: define(`_MTA_HOST_', `[127.0.0.1]')
  to deliver directly to localhost IP instead of going through DNS
- submit.mc: exchange msp and use_ct_file to better enable it
- do not undefine UUCP_RELAY and BITNET_RELAY
- sendmail.mc: use LOCAL_DOMAIN instead of "Cw" directly
- sendmail.mc: add commented out MASQUERADE_AS example
- re-enable DAEMON variable for now- remove absolute path names from the PAM configuration, allowing it to be
  used by any arch on a multilib system- fix mailman alias  #75129- update to 8.12.6- Drop optflags to default to build correctly on s390(x).- Added fix to build on x86_64- clean up some specfile cruft
- add more pseudo accounts to /etc/aliases- Only generate new cf files if the /usr/share/sendmail-cf/m4/cf.m4 exists.- Changed the behaviour in /etc/mail/Makefile to generate the sendmail.cf and
  submit.cf from the mc files if they changed.
- Added a small README.redhat that descibed the new mc file behaviour and the
  split into sendmail.cf and submit.cf.- suggestions form Stephane Lentz:
	- add correct include statement into submit.mc (like sendmail.mc)
	- add commented out further suggestions into submit.mc
	- disable ident lookups- fix initscript for thej11@120pending_exception (Mikulas Patocka ) [496100]
- [md] race conditions in snapshots (Mikulas Patocka ) [496100]
- [md] dm-raid1: switch read_record from kmalloc to slab (Mikulas Patocka ) [496101]
- [md] dm-raid1/mpath: partially completed request crash (Mikulas Patocka ) [496101]
- [md] snapshot: store damage (Mikulas Patocka ) [496102]
- [scsi] cciss: change in discovering memory bar (Tomas Henzl ) [474392]
- [scsi] cciss: version change for RHEL-5.4 (Tomas Henzl ) [474392]
- [scsi] cciss: thread to detect config changes on MSA2012 (Tomas Henzl ) [474392]
- [scsi] cciss: changes in config functions (Tomas Henzl ) [474392]
- [openib] update all the backports for the code refresh (Doug Ledford ) [476301]
- [openib] add support for XRC queues (Doug Ledford ) [476301]
- [openib] RDS: add the RDS protocol (Doug Ledford ) [477065]
- [openib] IPoIB: update to OFED 1.4.1-rc3 (Doug Ledford ) [434779 466086]
- [openib] SRP: update to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] SDP: update to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] qlgc_vnic: update to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] cxgb3: update driver to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] iw_nes: update NES iWARP to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] mthca: update driver to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] ipath: update driver to OFED 1.4.1-rc3 (Doug Ledford ) [230035 480696]
- [openib] ehca: update driver for RHEL-5.4 (Doug Ledford ) [466086]
- [openib] core: disable lock dep annotation (Don Zickus ) [476301]
- [openib] core: update core code to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] rmda: update rdma headers to OFED 1.4.1-rc3 (Doug Ledford ) [476301]
- [openib] mlx4: Update mlx4_ib and mlx4_core, add mlx4_en (Doug Ledford ) [456525 477065]
- [openib] enable mlx4_en and rds, disable iw_c2 (Doug Ledford ) [476301]
- [mm] add tracepoints (Larry Woodman ) [493444]- [net] bonding: ignore updelay param when no active slave (Jiri Pirko ) [495318]
- [net] ipv6: fix incoming packet length check (Jiri Pirko ) [492972]
- [misc] drivers fix dma_get_required_mask (Tomas Henzl ) [475455]
- [gfs2] NFSv2 support (Steven Whitehouse ) [497954]
- [ppc64] set error_state to pci_channel_io_normal (AMEET M. PARANJAPE ) [496872]
- [mm] allow tuning of MAX_WRITEBACK_PAGES (Larry Woodman ) [479079]
- [trace] add 'success' to sched_wakeup/sched_wakeup_new (Jason Baron ) [497414]
- [scsi] update iscsi layer and drivers for RHEL-5.4 (mchristi@redhat.com ) [436791 484455]
- [crypto] fips: panic box when module validation fails (Neil Horman ) [497228]
- [scsi] st: option to use SILI in variable block reads (Tom Coughlan ) [457970]
- [net] bonding: support for bonding of IPoIB interfaces (Andy Gospodarek ) [430758]
- [net] bonding: update to upstream version 3.4.0 (Andy Gospodarek ) [462632]
- [scsi] add md3000 and md3000i entries to rdac_dev_list (John Feeney ) [487293]
- [trace] tracepoints for page cache (KII Keiichi ) [475719]
- [trace] tracepoints for network socket (KII Keiichi ) [475719]
- [scsi] stex: support promise 6Gb sas raid controller (David Milburn ) [492022]
- [scsi] add ALUA scsi device handler (mchristi@redhat.com ) [482737]
- [scsi] update fnic fcoe driver for RHEL-5.4 (mchristi@redhat.com ) [484438]
- [scsi] update libfc/fcoe for RHEL-5.4 (mchristi@redhat.com ) [484438]
- [video] efifb: driver update (Brian Maly ) [488820]
- [fs] fix softlockup in posix_locks_deadlock (Josef Bacik ) [476659]
- [fs] cifs: unicode alignment and buffer sizing problems (Jeff Layton ) [494280] {CVE-2009-1439}
- [mm] vmscan: bail out of direct reclaim after max pages (Rik van Riel ) [495442]
- [crypto] add self-tests for rfc4309 (Jarod Wilson ) [472386]
- [crypto] handle ccm dec test vectors expected to fail (Jarod Wilson ) [472386]
- [crypto] fix rfc4309 deadlocks (Jarod Wilson ) [472386]
- [scsi] marvell sas: comment cleanup (Rob Evers ) [485126]
- [scsi] marvell sas: correct bit-map implementation (Rob Evers ) [485126]
- [scsi] marvell sas: initial patch submission (Rob Evers ) [4851jPw@on ) [253663]
- [nfs] infrastructure changes for silly renames (Steve Dickson ) [253663]
- [nfs] introducde nfs_removeargs and nfs_removeres (Steve Dickson ) [253663]
- [xen] avoid dom0 hang when disabling pirq's (Chris Lalancette ) [372741]
- [ppc64] cell: support for msi on axon (Scott Moser ) [253212]
- [ppc64] cell: enable rtas-based ptcal for xdr memory (Scott Moser ) [253212]
- [ppc64] cell: ddr2 memory driver for axon (Scott Moser ) [253212]
- [ppc64] spu: add temperature and throttling support (Scott Moser ) [279171]
- [ppc64] sysfs: support for add/remove cpu sysfs attr (Scott Moser ) [279171]
- [ppc64] cbe_cpufreq: fixes from 2.6.23-rc7 (Scott Moser ) [279171]
- [ppc64] typo with mmio_read_fixup (Scott Moser ) [253208]
- [ppc64] spufs: feature updates (Scott Moser ) [253208]
- [ppc64] export last_pid (Scott Moser ) [253208]
- [ppc64] cell: support pinhole-reset on blades (Scott Moser ) [253208]
- [s390] use IPL CLEAR for reipl under z/VM (Hans-Joachim Picht ) [386991]
- [net] sunrpc: fix hang due to eventd deadlock (Jeff Layton ) [246642]
- [misc] : misrouted interrupts deadlocks (Dave Anderson ) [247379]
- [fs] ignore SIOCIFCOUNT ioctl calls (Josef Bacik ) [310011]
- [ppc64] fixes PTRACE_SET_DEBUGREG request (Roland McGrath ) [253117]
- [fs] dm crypt: memory leaks and workqueue exhaustion (Milan Broz ) [360621]
- [md] dm: panic on shrinking device size (Milan Broz ) [360151]
- [md] dm: bd_mount_sem counter corruption (Milan Broz ) [360571]
- [fs] udf: fix possible leakage of blocks (Eric Sandeen ) [221282]
- [fs] udf: Fix possible data corruption (Eric Sandeen ) [221282]
- [fs] udf: support files larger than 1G (Eric Sandeen ) [221282]
- [fs] udf: add assertions (Eric Sandeen ) [221282]
- [fs] udf: use get_bh (Eric Sandeen ) [221282]
- [fs] udf: introduce struct extent_position (Eric Sandeen ) [221282]
- [fs] udf: use sector_t and loff_t for file offsets (Eric Sandeen ) [221282]
- [misc] use touch_softlockup_watchdog when no nmi wd (Prarit Bhargava ) [367251]
- [misc] backport upstream softlockup_tick code (Prarit Bhargava ) [367251]
- [misc] pass regs struct to softlockup_tick (Prarit Bhargava ) [336541]
- [misc] fix bogus softlockup warnings (Prarit Bhargava ) [252360]
- [x86] use pci=bfsort for certain boxes (Michal Schmidt ) [242990]
- [x86] Change command line size to 2048 (Prarit Bhargava ) [247477]
- [misc] systemtap uprobes: access_process_vm export (Frank Ch. Eigler ) [424991]
- [nfs] fix ATTR_KILL_S*ID handling on NFS (Jeff Layton ) [222330]
- [mm] oom: prevent from killing several processes (Larry Woodman ) [392351]- [xen] x86: suppress bogus timer warning (Chris Lalancette ) [317201]
- [xen] ia64: saner default mem and cpu alloc for dom0 (Jarod Wilson ) [248967]
- [xen] x86_64: add stratus hooks into memory (Kimball Murray ) [247833]
- [ia64] mm: register backing store bug (Luming Yu ) [310801]
- [serial] irq -1 assigned to serial port (Luming Yu ) [227728]
- [utrace] s390 regs fixes (Roland McGrath ) [325451]
- [x86] use pci=bfsort on Dell R900 (Michal Schmidt ) [242990]
- [nfs] server support 32-bit client and 64-bit inodes (Peter Staubach ) [253589]
- [nfs] support 32-bit client and 64-bit inode numbers (Peter Staubach ) [253589]
- [dlm] Don't overwrite castparam if it's NULL (Patrick Caulfield ) [318061]
- [s390] panic with lcs interface as dhcp server (Hans-Joachim Picht ) [350861]
- [s390] qeth: do not free memory on failed init (Hans-Joachim Picht ) [330211]
- [s390] qeth: default performace_stats attribute to 0 (Hans-Joachim Picht ) [248897]
- [s390] qeth: create copy of skb for modification (Hans-Joachim Picht ) [354861]
- [s390] qeth: up sequence number for incoming packets (Hans-Joachim Picht ) [354851]
- [s390] qeth: use correct MAC address on recovery (Hans-Joachim Picht ) [241276]
- [s390] cio: handle invalid subchannel setid in stsch (Hans-Joachim Picht ) [354831]
- [s390] cio: Dynamic CHPID reconfiguration via SCLP (Hans-Joachim Picht ) [253120]
- [s390] cio: fix memory leak when deactivating (Hans-Joachim Picht ) [213272]
- [s390] cio: Device status validkq-@--- second daemon and pidfile location #67910- update to 8.12.5- add further queue runs, slight spec-file cleanups- automated rebuild- update to 8.12.4, adjust smrsh patch- automated rebuild- update to 8.12.3- rebuilt- fix alternatives --remove  #61737
- add sendmail/SECURITY as docu #61870, #61545- add libsm.a    #61270
- change from /etc/sendmail.cf to /etc/mail/sendmail.cf
- add milter patch- ignore DAEMON=no; that configuration no longer functions- make sure more version information is in the cf file #54418
- do not use "-b" flag when patching in spec file
- require newer chkconfig version #61035
- fix preun script #60880
- add TMPF to access file creation #60956- mv include files to /usr/include/libmilter/ #60795
- do not use "-f" option to virtusertable #60196
- ad an example smarthost entry to config file #58298- use alternatives --initscript support
- run chkconfig --add before alternatives- run alternatives --remove in %preun
- add some prereqs- fix smmsp useradd invocation in %pre
- switch back to db3 for storing db files- update to 8.12.2 (adds STARTTLS support without need for sfio)
- don't forcibly strip binaries; let the build root handle it
- add creation of the smmsp account (51/51) in %pre
- enable hesiod map support
- modify default config to use an MSP
- comment out 'O AutoRebuildAliases' in %post, otherwise sendmail will
  fail to restart on upgrades- add proper ifdefs around new alternative stuff to also be able
  to build this for older releases- %triggerpostun on older versions to make sure alternatives work on
  upgrades- clean up alternatives somewhat, provide /usr/sbin/sendmail & friends- Use alternatives- fix quotation in spec-file- integrate ugly logic to compile this src.rpm also on older Red Hat
  Linux releases
- clean up spec file and patches a bit
- add db4 support- fix another path to correct docu
- include sendmail/README in the docu
- compile with -D_FFR_WORKAROUND_BROKEN_NAMESERVERS, but do not
  enable this at runtime
- devel subpackage files owned by root now- change "-q" to "-s" as option to make #57216
- move milter lib into separate "devel" sub-package
- add include files to devel sub-package #56064
- fix pointer in access file to docu #54351- add libmilter docu
- add support for userdb to /etc/mail/Makefile
- use "btree" database files if a userdb is used
- buildrequires tcp_wrappers- fix libmilter support
- fix init script to use /etc/mail/Makefile #52932- add libmilter library- update to 8.11.6
- correctly use /etc/mail/statistics- change init script back to older conventions #51297
- remove DoS patch, not needed anymore #51247- add option '-t' to procmail for local mail delivery- point to the map files in sendmail.cf as pointed out by
  David Beveridge <David@beveridge.com>- add build requires #49695
- do not call "userdel"- change sendmail.cf to "noreplace"- update to 8.11.4- update to 8.11.3
- add "localhost.localdomain" to the list of hostnames accepted
  for local delivery "Cw" in /etc/mail/sendmail.mc
- add patches from Pekka Savola <pekkas@netcore.fi>
	- Enable IPv6 at compile time, patch for glibc 2.2 from PLD
	- Add a commented-out IPv6 daemon .mc line to sendmail.mc
	- buildrequire: openldap-devel, cyrus-sasl-devel- rebuild in new environment- add noreplace for /etc/sysconfig/sendmail and /etc/mail/sendmail.mc- add changes from Christopher McCrory <chrismcc@pricegrabber.com>:
	- prepare /etc/mail/Makefile for more maps not shipped with this rpm
	- changed sendmail.mc to include some more commented out options,
	  so that people are directly pointed at important options
	- add /etc/pam.d/smtp for AUTH
	- add FEATURE(use_ct_file) and /etc/mail/trusted-users- don't obsolete postfix and exim, only conflict (for RHN purposes)- obsolete and conflict with exim and postfix- fix devision by zero bug in #20395
- mv /usr/lib/sendmail-cf /usr/share/sendmail-cf- i18n tweaks to initscript- aliases.db should be owned by group root- prepare for startup-script translation- enable daemon mode again, but only listen tok@@	an/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII C program textASCII English textHTML document textdirectorysymbolic link to `../../lib/libpam.so.0.81.5'symbolic link to `../../lib/libpam_misc.so.0.81.2'symbolic link to `../../lib/libpamc.so.0.81.0'RRR?`>i߈^?ѸǢ75T?UeGV(ʓ
HW(b?DVx;Ri´gsEy?UeGV(tB7uI<Mp$DHWdpaK%ٯnl2f754349e222f3aae4aa93789220280e92d47e57\=\<less devices 
  (Jiri Moskovcak <jmoskovc@redhat.com>) (rhbz#146291)
- added DNS for text interface (Jiri Moskovcak <jmoskovc@redhat.com>) 
  (rhbz#306601, rhbz#434990)
- fixed hosts parsing (Jiri Moskovcak <jmoskovc@redhat.com>) (rhbz#442460)
- Resolves: rhbz#146291 rhbz#201657 rhbz#217534 rhbz#218771 rhbz#241732
- Resolves: rhbz#291461 rhbz#433162 rhbz#440662 rhbz#440970 rhbz#441514 
- Resolves: rhbz#444320, rhbz#306601, rhbz#434990, rhbz#442460- added ? to dist tag in release
- Resolves: rhbz#184734- made DMA entries integer only (rhbz#184734, rhbz#432409)
- Resolves: rhbz#184734- recognize qeth devices in kudzu lists (rhbz#184734)
- Resolves: rhbz#184734- fixed MRU hydration (rhbz#221294)
- Resolves: rhbz#221294- added TUI support for s390 qeth devices (rhbz#184734)
- Resolves: rhbz#184734- fixed tracebacks for ISDN (rhbz#221292)
- Resolves: rhbz#221292- added MRU field (rhbz#221294)
- Resolves: rhbz#221294- fixed Makefile.am in gui
- Resolves: rhbz#227673- added QETH files in plugin (rhbz#227673)
- Resolves: rhbz#227673- added support for s390 qeth devices (rhbz#184734)
- removed CTC and IUCV support (rhbz#219180)
- preserve or add ::1 to /etc/hosts (rhbz#213709)
- do not touch ifcfg-*-range config files (rhbz#221292)
- default to static if BOOTPROTO unset and IP set (rhbz#227673)
- Resolves: rhbz#184734, rhbz#219180, rhbz#213709, rhbz#221292, rhbz#227673- obsolete netconfig
- Resolves: rhbz#237314- fixed #221289
- Resolves: rhbz#221289- translation update (bug #216559)
- Resolves: rhbz#216559- translation update- Resolvesi0%7@d ext2online device name canonicalisation for (eg) LVM symlinks- Build and package ext2online during the e2fsprogs build- Add ext2resize online resize tools to rpm- Enable the resize inode by default in mke2fs- Add initial ext2/3 online resize support- Close #125316 (buildreq texinfo, gettext)- rebuilt- fixed 'check after next mount' for filesystems with maximum mount count -1
  (#117109)- final 1.35- rebuilt- rebuilt- C++ header fix for ext2fs.h- newest WIP version (2004.01.31)- add patch from Dave Jones- update to 1.35-WIP-1207- Updated s390 patch. It's not not arch dependant anymore but only changes the
  default blocksizes when necessary.- own /lib/evwms directory  #109583
- build new rpm to get feedback on that snapshot- update the mainframe patch to its current version, but disable it
  until the change also properly supports SCSI and is usable also
  for non-mainframe archs- update to 1.35-pre
- use ldconfig to create symlinks to shared libs
- remove some cruft from the spec file
- man3 is now part of the devel rpm- update to 1.34
- do not strip some more apps, should probably just change $(STRIP)...- rebuilt- update to 1.33
- enable translations- fix error message, do block size checking on s390 only- check the return code of BLKSSZGET ioctl() to avoid breaking with files- Improved dasd blocksize patch to make it more generic and work correctly.- Removed sync call from e2fsck target. Not needed anymore.- Fixed problem with mke2fs and default blocksize small partitions on dasd
- Disabled Florians patch for now as it's a little incomplete. :-)- add an ugly patch to read full lines of input during e2fsck for /dev/console- rebuilt- do *not* create htree filesystems by default- update to 1.32- update to 1.30, leave out already integrated patches
- clean up spec file
- also package some missing files- update to 1.29, adapt patches to current source- add missing man-pages to filelist- automated rebuild- add HTree version of e2fsprogs, disable s390 patch
- add e2fsprogs-dir_index.patch- set default blocksize for mke2fs on S/390 and zSeries to 4096- automated rebuild- fix further bug in man-page #62995- fix man-pages- update to 1.27
- patch5 should not be needed anymore- Make link for mkfs.ext3 (patch5)
- Add man pages for {mkfs,fsck}.{ext2,ext3}- update to 1.26- automated rebuild- update to 1.25
- patch for BLKGETSIZE64 is not needed anymore
- adapt autoconf-2.50 patch- Make the C++ patch work even with g++ 3.1- Fix headers of libext2fs - it wasn't possible to include them from
  C++ code (using private as a variable name isn't a good idea)
- Fix build with autoconf 2.5x- add e2image to filelist- disable BLKGETSIZE64 ioctl support for now- update to 1.23. This was requested to support the "auto" fstype
  to ease ext2 <-> ext3 conversions.- add some more man-pages, patch by <Martin.Wilck@fujitsu-siemens.com>- make sure "configure" is writable- update to 1.22- update to 1.21- add endian patch from sct@redhat.com  #44104- update to 1.20
- add Url- make sure ldconfig doesn't have any input and scripts end
  with "exit 0"- update to e2fsprogs-1.20-WIP-0514.tar.gz- Added 16K buffer for reading /proc/partitions in 
  get_label_by_device.c to correct problems with LABEL= in fsck 
  caused by not reading /proc/partitions in a single read() call;
  if somebody has a "partitions" > 16K, it may still fail ...- add further IDE and SCSI disks to a hardcoded list in fsck #34190- require the main rpm from the devel rpm- fix fsck -A bug (#21242)- fix bug with 16 byte long labels #27071- build for Red Hat 7.1.- merge LABEL patch.
- update to 1.19.- fixed LABEL handling- rebuild to cope with glibc locale binary incompatibility- automatic rebuild- added resize2fs from the WIP snapshot- patched to build against linux 2.4 headers- FHS packaging.- fix for ia64- add install-info scripts- Fix bug #8585 (Y2K problems in debugfs)- allow multiline errors in et, so that other programs
  can use compile_et (from Kerberos)- build 1.18 for 6.2.- updateh\
 [-@-,..hmd5.hmichaelmic.hmpilib.hnhmac.hnull.hrng.hseqiv.hserpent.hsha1.hsha256.hsha512.hsignaturesignature.hdsa.htea.htest.htgr192.htwofish.hwp512.hxcbc.hxts.hcyclades.hdavicomphy.hdca.hdcdbas.hdeaoc.hde2104x.hde4x5.hdebugfs.hinfo.hkernel.hlist.hrodata.hstackoverflow.hdefaultcfq.hiosched.hdefconfiglist.hdellrbu.hwmi.hdetecthungtask.hsoftlockup.hdl2k.hdlmdlm.hdebug.hdmcrypt.hmirror.hmultipathmultipath.hemc.hhp.hrdac.hraid45.hsnapshot.huevent.hzero.hdm9102.hdmaengineengine.hv3.hdmardmar.hfloppywa.hgfxwa.hdmi.hdnotify.hdrmdrm.hi810.hi830.hi915.hmga.hr128.hradeon.hsavage.hvia.hdtlk.hdummydummy.hconsole.he100.he1000e1000.hnapi.he1000e.hearlyprintk.hecryptfs.hedacedac.hamd64.hdecodemce.he752x.hi3000.hi3200.hi5000.hi5400.hi7300.hi7core.hk8.hmce.hmmedac.hpoll.hedd.heeprom93cx6.hefipartition.helfcore.henclosureservices.henic.hepic100.hepoll.heventfd.hexperimental.hexportfs.hext2fsfs.hposixacl.hsecurity.hxattr.hxip.hext3fsfs.hposixacl.hsecurity.hxattr.hext4debug.hfsfs.hposixacl.hsecurity.hxattr.hext4devcompat.hfatdefaultcodepage.hiocharset.hfs.hfbfb.hcfbcopyarea.hfillrect.himageblit.hcirrus.hintel.hkyro.hmodehelpers.hnvidianvidia.hi2c.hriva.hsavagesavage.haccel.hi2c.htileblitting.hvesa.hvga16.hfcoefcoe.hfnic.hfddi.hfealnx.hfibrules.hfirewirefirewire.hohciohci.hdebug.hsbp2.hfixedmii10fdx.h100fdx.hphy.hfont8x16.h8x8.hforcedeth.hframebufferconsoleconsole.hrotation.hfsmbcache.hposixacl.hxip.hfscache.hftl.hfusefs.hfusionfusion.hctl.hfc.hlan.hlogging.hmaxsge.hsas.hspi.hfutex.hfwloader.hgactprob.hgameportgameport.hemu10k1.hfm801.hl4.hns558.hgenericallocator.hcalibratedelay.hcpu.hhardirqs.hhweight.hiomap.hirqprobe.hisadma.hpendingirq.hgfs2fsfs.hlockingdlm.hnolock.hgigasetbase.hm105.hhangchecktimer.hhappymeal.hhasdma.hiomem.hioport.hhavearchearlypfntonid.hgetuserpagesfast.hmemorypresent.hoptprobes.hhermes.hhfsfs.hhfsplusfs.hhidff.hpid.hhisax163.h1tr6.havma1cs.hpcmcia.hbkma4t.hdiehldiva.helsaelsa.hcs.henternowpci.heuro.hfritzpcipnp.hfritzpci.hgazel.hhdlc.hhfcpci.hsx.hhfc4s8s.hmaxcards.hnetjetnetjet.hu.hni1.hniccy.hnokeypad.hllc.hsendcomplete.hs0box.hsctquadro.hsedlbauersedlbauer.hcs.hst5481.htelescs.htelespci.hw6692.hhostaphostap.hcs.hfirmwarefirmware.hnvram.hpci.hplx.hhotplughotplug.hcpu.hpcipci.hacpiacpi.hibm.hfake.hpcie.hshpc.hhpilo.hhpethpet.hemulatertc.htimer.hhugetlbpage.hhugetlbfs.hhwconsole.hrandomrandom.hamd.hintel.hhwmonhwmon.hvid.hhzhz.h1000.hi2ci2c.halgobit.halgopca.halgopcf.hamd756amd756.hs4882.hamd8111.hchardev.hi801.hisa.hnforce2.hparportparport.hlight.hpiix4.hprosavage.hsavage4.hsis96x.hstub.hvia.hviapro.hvoodoo3.hi2oi2o.hblock.hbus.hconfigconfig.holdioctl.hextadaptecadaptec.hdma64.hproc.hscsi.hi6300esbwdt.hi8xxtco.hia32emulation.hibmasr.hibmol.hideide.hgeneric.htaskioctl.hidediskmultimode.hidedmaauto.hpciauto.hidepcishareirq.hieee80211ieee80211.hcryptccmp.htkip.hwep.hsoftmacsoftmac.hdebug.hifb.higbigb.hdca.higbvf.hinetinet.hah.hdccpdiag.hdiag.hesp.hipcomp.hlro.htcpdiag.htunnel.hxfrmmodetransport.htunnel.htunnel.hinet6ah.hesp.hipcomp.htunnel.hxfrmmodetransport.htunnel.htunnel.hinfinibandinfiniband.haddrtrans.hcxgb3.hcxgb4.hipath.hipoibipoib.hcm.hdebug.hiser.hmadeye.hmthcamthca.hdebug.hnes.hqlgcvnic.hsdpsdp.hdebugdebug.hdata.hsrp.huseraccess.hmad.hmem.hinitenvarglimit.hinitramfssource.hinotifyinotify.huser.hinputinput.hevdev.hjoydev.hjoystick.hkeyboard.hmisc.hmouse.hmousedevmousedev.hscreenx.hy.hpcspkr.hpolldev.htouchscreen.huinput.hintelioatdmaioatdma.hv3.hiommuiommu.hapi.hhelper.hioschedas.hcfq.hdeadline.hnoop.hipadvancedrouter.hdccpdccp.hackvec.hccid2.k0@@@JJlibpam.so.0libpam_misc.so.0libpamc.so.0pamrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)0.99.6.2-14.el5_113.0.4-14.0-14.4.2.3U]UI=`P1OOj`O2`LKs`J9g`J	`IH}G`FFF|F`F1 F-,`F`F
`EX`EE`EE`E'`E'`EEE`EpEoT`E[E>E4E0`EEDD[D۬`D۬`D `DN`DN`D`DpD`DDDt`DkDjK`Dbb`DZy`DO`DNCCC`C`CC8C`C`CzZ`C_`C_`CP*`CNCB`C=`C0`CB`BB`Bl`B&`B`BBB]BvBnBaB\DBVBU`BS
`BPg`BLrBAB;O`B6	`B0`B$BYAAA`AUAA2`AA`AvAvAu`Ak`Ak`AYASG`AK^`AF`AF`A3`A\`A	s`A`A`@@f@Z`@q`@Lj`@`@M@`@`@}`@{`@FU`@E@>l`@>l`@-H@+`@)T`@"@ @`@0@0@0@@<`@
`@
`@
`?:`??"`?9`??`?O`??Z?f`?f`??se`?r?r?h`?Y`?%?%?%? V??`?	`?`?`?>`>k>H >/`=`==W`=`=`=`==K=E===[<f`<<+<d`<`<<<(<<<um<dJ`<b<Y`<O2`;u`;Q;;`;9;Ԗ;\`;!;-`;;`;8;;`;`;;;;;`;N;`;+`;xM;tY`;s;J)`;D`;B@`;<`;7`;
`::`::<`::˙`:`:::F::`:]:#`:::`:`::`:\:`:"`:w9`:m:l`:k[:h:f:_~`:\`:[:>:6:&:%|`:$*:`::)9n9`999K`9ۨ`9`9`9`9`999``9k9<99~
9|`9z`9x9l`9l`9k9a9N9H`9<"9<"99969 s`9f8֟`8`8`8838q87`77`7`7{7`77a`777`77
&7`66`666w`66Ĥ`6`6z`Tomas Mraz <tmraz@redhat.com> 0.99.6.2-14Tomas Mraz <tmraz@redhat.com> 0.99.6.2-13Tomas Mraz <tmraz@redhat.com> 0.99.6.2-12Tomas Mraz <tmraz@redhat.com> 0.99.6.2-11Tomas Mraz <tmraz@redhat.com> 0.99.6.2-10Tomas Mraz <tmraz@redhat.com> 0.99.6.2-9Tomas Mraz <tmraz@redhat.com> 0.99.6.2-8Tomas Mraz <tmraz@redhat.com> 0.99.6.2-7Tomas Mraz <tmraz@redhat.com> 0.99.6.2-6Tomas Mraz <tmraz@redhat.com> 0.99.6.2-5Tomas Mraz <tmraz@redhat.com> 0.99.6.2-4.1Tomas Mraz <tmraz@redhat.com> 0.99.6.2-4Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.27Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.26Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.25Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.23Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.22Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.21Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.19Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.18Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.17Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.15Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.14Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.13Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.12Dan Walsh <dwalsh@redhat.com> 0.99.6.2-3.11Dan Walsh <dwalsh@redhat.com> 0.99.6.2-3.10Dan Walsh <dwalsh@redhat.com> 0.99.6.2-3.9Dan Walsh <dwalsh@redhat.com> 0.99.6.2-3.8Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.7Dan Walsh <dwalsh@redhat.com> 0.99.6.2-3.6Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.5Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.4Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.3Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.2Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3.1Tomas Mraz <tmraz@redhat.com> 0.99.6.2-3Tomas Mraz <tmraz@redhat.com> 0.99.6.2-2Tomas Mraz <tmraz@redhat.com> 0.99.6.2-1Dan Walsh <dwalsh@redhat.com> 0.99.5.0-8Tomas Mraz <tmraz@redhat.com> 0.99.5.0-7Tomas Mraz <tmraz@redhat.com> 0.99.5.0-6Tomas Mraz <tmraz@redhat.com> 0.99.5.0-5Tomas Mraz <tmraz@redhat.com> 0.99.5.0-4Tomas Mraz <tmraz@redhat.com> 0.99.5.0-3Jesse Keating <jkeating@redhat.com> - 0.99.5.0-2.1Tomas Mraz <tmraz@redhat.com> 0.99.5.0-2Tomas Mraz <tmraz@redhat.com> 0.99.5.0-1Tomas Mraz <tmraz@redhat.com> 0.99.4.0-5Tomas Mraz <tmraz@redhat.com> 0.99.4.0-4Tomas Mraz <tmraz@redhat.com> 0.99.4.0-3Tomas Mraz <tmraz@redhat.com> 0.99.4.0-2Tomas Mraz <tmraz@redhat.com> 0.99.4.0-1Tomas Mraz <tmraz@redhat.com> 0.99.3.0-5Tomas Mraz <tmraz@redhat.com> 0.99.3.0-4Tomas Mraz <tmraz@redhat.com> 0.99.3.0-3Tomas Mraz <tmraz@redhat.com> 0.99.3.0-2Jesse Keating <jkeating@redhat.com> - 0.99.3.0-1.2Jesse Keating <jkeating@redhat.com> - 0.99.3.0-1.1Tomas Mraz <tmraz@r6k-@m> 3.0.23c-2.el5.2.0.2Jay Fenlason <fenlason@redhat.com> 3.0.23c-2.el5.2Jay Fenlason <fenlason@redhat.com> 3.0.23c-2.el5.1Jay Fenlason <fenlason@redhat.com> 3.0.23c-2Jay Fenlason <fenlason@redhat.com> 3.0.23b-2Jay Fenlason <fenlason@redhat.com> 3.0.23a-3Jay Fenlason <fenlason@redhat.com> 3.0.23a-2Jay Fenlason <fenlason@redhat.com> 3.0.23-2Jay Fenlason <fenlason@redhat.com> 3.0.23-0.RC3Tomas Mraz <tmraz@redhat.com> - 2.0.21c-3Jay Fenlason <fenlason@redhat.com> 2.0.21c-2Jay Fenlason <fenlason@redhat.com> 3.0.21b-2Jesse Keating <jkeating@redhat.com> - 0:3.0.20b-2.1.1Jesse Keating <jkeating@redhat.com>Jay Fenlason <fenlason@redhat.com> 3.0.20b-2Warren Togami <wtogami@redhat.com> 3.0.20-3Jay Fenlason <fenlason@redhat.com> 3.0.20-2Jay Fenlason <fenlason@redhat.com> 3.0.14a-2Jay Fenlason <fenlason@redhat.com> 3.0.13-2Florian La Roche <laroche@redhat.com>Tomas Mraz <tmraz@redhat.com> 3.0.11-5Jay Fenlason <fenlason@redhat.com> 3.0.11-4Jay Fenlason <fenlason@redhat.com> 3.0.11-3Jay Fenlason <fenlason@redhat.com> 3.0.11-2Jay Fenlason <fenlason@redhat.com> 3.0.10-4Tim Waugh <twaugh@redhat.com> 3.0.10-3Jay Fenlason <fenlason@redhat.com> 3.0.10-2Jay Fenlason <fenlason@redhat.com> 3.0.9-2Than Ngo <than@redhat.com> 3.0.8-4Jay Fenlason <fenlason@redhat.com> 3.0.8-3.1Jay Fenlason <fenlason@redhat.com> 3.0.8-3Jay Fenlason <fenlason@redhat.com> 3.0.8-2Jay Fenlason <fenlason@redhat.com> 3.0.8-0.pre2Jay Fenlason <fenlason@redhat.com> 3.0.8-0.pre1.3Jay Fenlason <fenlason@redhat.com> 3.0.8-0.pre1.2Jay Fenlason <fenlason@redhat.com> 3.0.8-0.pre1.1Jay Fenlason <fenlason@redhat.com>Jay Fenlason <fenlason@redhat.com> 3.0.8-0.pre1Jay Fenlason <fenlason@redhat.com> 3.0.7-4Jay Fenlason <fenlason@redhat.com> 3.0.7-3Jay Fenlason <fenlason@redhat.com> 3.0.6-3Jason Vas Dias <jvdias@redhat.com> 3.0.5-3Jay Fenlason <fenlason@redhat.com> 3.0.5-2Jay Fenlason <fenlason@redhat.com> 3.0.5-0.pre1.1Jay Fenlason <fenlason@redhat.com> 3.0.5.0pre1.0Elliot Lee <sopwith@redhat.com>Jay Fenlason <fenlason@redhat.com> 3.0.3-5Jay Fenlason <fenlason@redhat.com> 3.0.3-4jay Fenlason <fenlason@redhat.com> 3.0.3-3.rc1Jay Fenlason <fenlason@redhat.com> 3.0.3-2.pre2Jay Fenlason <fenlason@redhat.com> 3.0.3-1.pre1Elliot Lee <sopwith@redhat.com>Jay Fenlason <fenlason@redhat.com> 3.0.2a-1Karsten Hopp <karsten@redhat.de> 3.0.2-7 Elliot Lee <sopwith@redhat.com>Jay Fenlason <fenlason@redhat.com>Jay Fenlason <fenlason@redhat.com> 3.0.2-5Jay Fenlason <fenlason@redhat.com> 3.0.2-3rc2Jay Fenlason <fenlason@redhat.com> 3.0.2-1rc1Felipe Alfaro Solana <felipe_alfaro@linuxmail.org> 3.0.1-1Jay Fenlason <fenlason@redhat.com> 3.0.0-15Jay Fenlason <fenlason@redhat.com>Jay Fenlason <fenlason@redhat.com> 3.0.0-3beta3Nalin Dahyabhai <nalin@redhat.com> 2.2.8a-4Elliot Lee <sopwith@redhat.com>Jay Fenlason <fenlason@redhat.com> 2.2.8a-2Florian La Roche <Florian.LaRoche@redhat.de>Jay Fenlason <fenlason@redhat.com> 2.2.8a-1Jay Fenlason <fenlason@redhat.com> 2.2.8-0Elliot Lee <sopwith@redhat.com>Jonathan Blandford <jrb@redhat.com> 2.2.7a-5Nalin Dahyabhai <nalin@redhat.com> 2.2.7a-4Jay Fenlason <fenlason@redhat.com> 2.2.7a-3Tim Powers <timp@redhat.com>Jay Fenlason <fenlason@redhat.com> 2.2.7a-1Jeff Johnson <jbj@redhat.com> 2.2.7-5Tim Powers <timp@redhat.com> 2.2.7-4Elliot Lee <sopwith@redhat.com> 2.2.7-3Bill Nottingham <notting@redhat.com> 2.2.7-2Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-10Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-9Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-8Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-7Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-6Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-5Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-4Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-3Tim Powers <timp@redhat.com>Trond Eivind Glomsrd <teg@redhat.com> 2.2.5-1Trond Eivind Glomsrd <teg@redhat.com> 2.2.4-5Trond Eivind Glomsrd <teg@redhat.com> 2.2.4-4Tim Powers <timp@redhat.com>Trond Eivind Glomsrd <teg@redhat.com> 2.2.4-2Trond Eivind Glomsrd <teg@redhat.com> 2.2.4-1TrkX@a5fd2dcf34038c8d8cc05024f682f0f7d06326a8185ff20780d888ef27f4497082b741f660544ab61fa5214b2528c7b8d657ce05a6956d155dfaf234c7c59838236a8f731bbf56a5200cb0a99a3403144ebfe12eaf561bb7d14de219055036aa6c06b560702c41e8c574c9d25aeecb5716d5307e563beb0c932ea7a8afca29ab4ba9b69d801b2a62624c12ca6eab5a5d5045be3e657664413b5696430b8152acd0f0ae863572d6f523f95d159e19689ad4ac38a151bf72c9091fa0b85ce6b13747ae4000377e9f763532d365c2763332a7d22a57ae0fd0486d4850b3ddf5fec7a36c90b9f89e7af98e370814f8f1ded7b96c12226af38a61f15bd87406090eb8e1ca12577c1b4342700ab3df794e55df0b9e3ac5d0bc9c97ef5395bba00a099ea7ac613ca2de9799e74b75c4021314a870bd19e94af9b2867bf6d83daee3cd3da4217d0aa7f3767ae8ecb13fe606184b1bc1ac59ab03e60c504034d162248cb0194449f5bd5b5a2b4cd2a16494f11fbaf68e6496b319ad03c1082510bb55e746d8a7339a1c654326d5f6b935e3d96d8f334d76041c1e210b80ae23bb4898cd9bc965b5493a6c41f86a91c9a57fd1acd610f28d0e6f1f1607251a4c8d4cd00f2606b84e19bd7e5332ee08382fd6b19f0d1d53a2bd16da69a5feacc3a49b01af648f31bc19379a58ea483403e10554e3030863777f25b966d25375f6de0e56b295705cbf85e70fad256f1a26f8761abec733d9b13b22e784472e5ac7a245de2b5e16ecee91622a8f287aa04449b102a8517073d6554f30beb89f6521997266f7373bf00f6859f27170b4315246951e23323982612d0e28507bb0359fed6c27f3a32282e599f9f31a4623e8398392551453709aabe67509c1636d175962292c90fd7e37d380caf3965f7dd8ffc14e101b4189d0f1ec7cb0a6b99bc9594a2187287f242857a3ed835012b3ff444cd27b4867a7f3350ca2080f4a00c0ab1106bb925411ca24688196cc3d930d59d72dd8bb111b7483d99bdb04b66242c92308dd6070de95a7c53b5bc1bc742c92021005c3f938e2fcf7df9d928d39b29aad03357e34df3f3e69d40112d0fe0845bfe3cf42552ab5ecfae63174b87dc765077d3cf1b2efbf644e9b81fb7d9b6bd75c0223eff8028603ca262546fa877eec147901eb7ae53220302e14ad29f28f7a96248e49d25a110a705ad9f58e4e914325cb0dbf8d360f63d2fe79e07985e6dbc824b2e0057ab5f42702828c86ca5486c09353657f03a421b6029f5773dcd9508a417fd8fe249e7995fdcdcc9f278a3ed525957785a4d87cc86e58b8ef14bc1bfdf1274379d7488ce49ce5e564f4748bacd3916987d2d7824b3eb9d7fcd79../../lib/libpam.so.0.81.5../../lib/libpam_misc.so.0.81.2../../lib/libpamc.so.0.81.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpam-0.99.6.2-14.el5_11.src.rpmpam-devel@
l.@... new location for statistics file (/var/log/)- Fix download url.- rebuild against db-4.2.52.- fix pam alternatives handling
- add patch from Jakub Jelinek for PIE- fix usage of RPM_OPT_FLAGS variable in spec file
- add makecert.sh script to -doc subpackage
- add cert paths to sendmail.mc- fix alternatives (#109313)
- enable TLS- add some more system account entries into /etc/aliases
- add example for a mixed IPv6/IPv4 setup- added with_ options- rebuild against db-4.2.42.- update to 8.12.10- add security patches for CAN-2003-0694 and CAN-2003-0681- move debug information from sendmail into debuginfo rpm
- on %post make sure /etc/aliases.db and /etc/mail/*.db is correctly
  owned by root
- do not set confTRUSTED_USER to smmsp in sendmail-redhat.mc- run "make -C /etc/mail" (maybe generating new sendmail.cf, then newaliases
- added $SENDMAIL_OPTARG that could be set by /etc/sysconfig/sendmail #99224- adjust rpm license tag to say "Sendmail"- enable pie only for a few archs
- enable full optims for s390 again, compiler seems to be fixed- apply patch from Ulrich Drepper to support -pie- rebuilt- make init script more robust #91879- sendmail-cf requires m4, #90513- move Sendmail.conf from /usr/lib/sasl to /usr/lib/sasl2 and change the
  default pwcheck method to "saslauthd"- configure to use libsasl2 instead of libsasl to avoid linking with both
  (we also link to libldap, which now uses libsasl2)
- link with -ldb instead of -ldb-4.0 on all releases after RHL 7.3 instead
  of just 7.3 (all versions of db4-devel thereafter are expected to provide
  the right linking setup)- add a "umask 022" before building the *.cf files in /etc/mail/Makefile- mark /etc/mail/Makefile as config(noreplace) #87688
- mark /etc/pam.d/smtp as config(noreplace) #87731- update to 8.12.9- call make with the target "all" #86005
- add start/stop/restart as Makefile targets
- add another security patch- add correct db4-devel requirements for newer releases
- completely re-do many ifdef code in the spec-file
- fix some issues building for older RHL releases- rebuilt- rebuilt- update to 8.12.8- rebuilt- rebuilt- add a confTRUSTED_USER line into sendmail.mc, submit.mc is already ok
- add patch from sendmail.org for cf/m4/proto.m4- do not reject all numeric login names if hesiod support is
  compiled in.   #80060
- remove reference to non-existing man-pages #74552- sendmail-8.12.7-etrn.patch from Jos Vos <jos@xos.nl>
- submit.mc: enable "use_ct_file" by default  #80519
- add _FFR_MILTER_ROOT_UNSAFE  #78223- update to 8.12.7
- hack to make lib64 version work
- downgrade s390 optims to make it compile- add openssl-devel as a build-time requirement
- preprocess the config file to add the right version of %{_lib}
- add kerberos -I and -L flags to build configuration, needed for newer
  versions of libssl- always have a queue run interval for sm-msp-queue   #81424
- Jos Vos suggests adding another variable for sm-client queue-run- add the following changes from Adrian Havill <havill@redhat.com>
  to our default sendmail.mc file:
	- added commented-out-by-default common AUTH/SSL examples
	- updated m4 example and rpm reference
	- added more comment documentation
	- add commented out confAUTO_REBUILD example
	- improve description about MASQUERADE_AS- add to submit.mc: define(`_MTA_HOST_', `[127.0.0.1]')
  to deliver directly to localhost IP instead of going through DNS
- submit.mc: exchange msp and use_ct_file to better enable it
- do not undefine UUCP_RELAY and BITNET_RELAY
- sendmail.mc: use LOCAL_DOMAIN instead of "Cw" directly
- sendmail.mc: add commented out MASQUERADE_AS example
- re-enable DAEMON variable for now- remove absolute path names from the PAM configuration, allowing it to be
  used by any arch on a multilib system- fix mailman alias  #75129- update to 8.12.6- Drop optflags to default to build correctly on s390(x).- Added fix to build on x86_64- clean up some specfile cruft
- add more pseudo accounts to /etc/aliases- Only generate new cf files if the /usr/share/sendmail-cf/m4/cfj @th compat ioctls- xen update:
  * linux-2.6 changeset: 34228:ea3369ba1e2c
  * linux-2.6-xen-fedora changeset: 36107:47256dbb1583
  * linux-2.6-xen changeset: 22905:d8ae02f7df05
  * xen-unstable changeset: 11460:1ece34466781ec55f41fd29d53f6dafd208ba2fa- Fix task->mm refcounting bug in execshield. (#191094)
- 2.6.18rc7-git2
- 586 SMP support.- Implement futex primitives on IA64 and wire up [gs]et_robust_list again
  (patch from Jakub, #206613)- fix slab corruption when starting qla4xxx with iscsid not started.- add include/asm-x86_64/const.h to exported header file list
  used by the x86 relocatable patch (inside include/asm-x86_64/page.h)- kprobe changes to make systemtap's life easier.- sync up beta1 fixes and patches
   - includes infiniband driver
   - aic9400/adp94xx updates
   - squashfs s390 fix
- include x86 relocatable patch at end of list
- some /proc/kcore changes for x86 relocatable kernel- 2.6.18rc7-git1
- header file fixups
- use correct arch for 'make headers_install' when cross-building- 2.6.18rc7- Export <linux/netfilter/xt_{CONN,}SECMARK.h> (#205612)- 2.6.18rc6-git4
- Enable IFB driver. (#204552)
- Export copy_4K_page for ppc64- GFS2 update- s390 single-step fix- Add a PCI ID to sata_via
- Intel i965 DRM support.
- Fix NFS/Selinux oops. (#204848)- 2.6.18rc6-git3- 2.6.18rc6-git2- 2.6.18rc6-git1
- GFS2/DLM updates.- New utrace patch: fix 32-bit PTRACE_PEEKUSR for FP regs on ppc64. (#205179)- Undo rhel5 xen patch for relocatable.- AGP support for Intel I965- Update xenfb based on upstream review- Numerous sparse fixes to Tux.- update iscsi layer to what will be in 2.6.19-rc1- NFS lockdep fixes.
- Make ia64 Altix IDE driver built-in instead of modular. (#205282)- xenoprof upstream fix.
- update xen HV to cset 11394.
- xen update (3hypercall incompatibility included)
- linux-2.6 changeset: 34073:b1d36669f98d
- linux-2.6-xen-fedora changeset: 35901:b7112196674e
- xen-unstable changeset: 11204:5fc1fe79083517824d89309cc618f21302724e29
- fix ia64 (xen & net xen).- 2.6.18rc6
- Drop recent NFS changes completely.- Fix bogus -EIO's over NFS (#204859)
- Enable ptrace in olpc kernels. (#204958)- Remove PAE, xen and kdump configs for olpc case- 2.6.18rc5-git7- Fix up typo in tux.patch
- 2.6.18rc5-git6- update xen-hv to cset 11256 (pre 3 hypercall breakage).
- remove debug=y from HV compilation.
- xen update (pre 3 hypercall breakage)
  * linux-2.6 changeset: 33957:421a6d428e95
  * linux-2.6-xen-fedora changeset: 35756:78332fcbe5b0
  * xen-unstable changeset: 11251:5fc1fe79083517824d89309cc618f21302724e29
  * get new irqflags code from linux-2.6.tip-xen.- Fix up DEFAULTKERNEL for kernel-xen[0U]->kernel-xen change- Fixes for DUB-E100 vB1 usb ethernet (backported from James M.)- 2.6.18-rc5-git1- Fix serial console with xen dom0- enabled EHEA driver
- x86 relocatable fixes
- audit code fixes for cachefs- Add updated pv framebuffer patch for Xen and re-enable the config options- ia64 xen fixing.- Fix V4L1 stuff in <linux/videodev.h> (#204225)- update xen HV to xen-unstable cset 11251.
- fix ia64 xen HV compilation.
- linux xen kernel update:
  * linux-2.6 changeset: 33681:2695586981b9
  * linux-2.6-xen-fedora changeset: 35458:b1b8e00e7a17
  * linux-2.6-xen changeset: 22861:0b726fcb6780
  * xen-unstable changeset: 11204:5fc1fe79083517824d89309cc618f21302724e29- build fix for ia64 kdump- update utrace
- more gfs2-dlm fixes
- fix xen-devel build directory issue
- add x86, x86_64 relocatable kernel patch for rhel only (davej, forgive my sins)
  - applied xen relocatable cleanup on top of it
- add ia64 kexec/kdump pieces- Enable i386 for olpc so that kernel-headers is built- Update GFS2 patch (from swhiteho)
- Enable kernel-headers build
- Enable i386 build _only_ for kernel-headers- Another lockdep-fix
- NFS fix for the connectathon test
- Enable mmtimer for ia64
- Add support for iscsi qla4xxx- Add Libertas wireless driver- New utrace patch: experimental support for ia64, sparc64.- 2.6.18rc4-git1- Update to latest upstream from GregKH's git tree.- xen k@j@6uf@fe Vecera) [956322]
- [net] be2net: Fix cleanup path when EQ creation fails (Ivan Vecera) [956322]
- [net] be2net: Fix Endian (Ivan Vecera) [956322]
- [net] be2net: Fix to trim skb for padded vlan packets (Ivan Vecera) [956322]
- [net] be2net: Explicitly clear reserved field in Tx Descriptor (Ivan Vecera) [956322]
- [net] be2net: remove unnecessary usage of unlikely() (Ivan Vecera) [956322]
- [net] be2net: do not modify PCI MaxReadReq size (Ivan Vecera) [956322]
- [net] be2net: cleanup be_vid_config() (Ivan Vecera) [956322]
- [net] be2net: don't call vid_config() when there no vlan config (Ivan Vecera) [956322]
- [net] be2net: Ignore status of some ioctls during driver load (Ivan Vecera) [956322]
- [net] be2net: Fix wrong status getting returned for MCC commands (Ivan Vecera) [956322]
- [net] be2net: Fix VLAN/multicast packet reception (Ivan Vecera) [956322]
- [net] be2net: fix wrong frag_idx reported by RX CQ (Ivan Vecera) [956322]
- [infiniband] cxgb4: Compile when CXGB4 is set, not CXGB3 (Doug Ledford) [871555]
- Revert: [infiniband] qib: add qib, mod ipath to only support HTX (Doug Ledford) [871555]
- Revert: [infiniband] Enable Kconfig for ipath (Doug Ledford) [871555]
- Revert: [infiniband] Revert upstream 'Infiniband: make ipath' (Doug Ledford) [871555]
- Revert: [infiniband] Revert upstream 'IB/ipath: Make ipath_port' (Doug Ledford) [871555]
- Revert: [infiniband] Revert upstream 'IB/ipath: Convert from ...' (Doug Ledford) [871555]
- Revert: [infiniband] Revert upstream 'cpumask: use new cpumask' (Doug Ledford) [871555]
- Revert: [infiniband] Import of backport patch from ofed 1.4.2 (Doug Ledford) [871555]
- Revert: [infiniband] Pull in backport from ofed 1.4.2 (Doug Ledford) [871555]
- Revert: [infiniband] aio_write not right entrypoint to use in our (Doug Ledford) [871555]
- Revert: [infiniband] make up for lack of HT_IRQ config option (Doug Ledford) [871555]
- Revert: [infiniband] Don't use vmalloc_user (Doug Ledford) [871555]
- Revert: [infiniband] More device->class_device conversions (Doug Ledford) [871555]
- Revert: [scsi] qla4xxx: ISP8xxx: Correct retry of adapter initial (Chad Dupuis) [978150]
- [net] af_key: fix info leaks in notify messages (Jiri Benc) [981000] {CVE-2013-2234}
- [net] af_key: initialize satype in key_notify_policy_flush() (Jiri Benc) [981224] {CVE-2013-2237}
- [net] Fix panic for vlan over gre via tun (Thomas Graf) [981337]
- [net] ipv6: ip6_sk_dst_check() must not assume ipv6 dst (Jiri Pirko) [981557] {CVE-2013-2232}- [net] sctp: Disallow new connection on a closing socket (Daniel Borkmann) [974936] {CVE-2013-2206}
- [net] sctp: Use correct sideffect command in dup cookie handling (Daniel Borkmann) [974936] {CVE-2013-2206}
- [net] sctp: deal with multiple COOKIE_ECHO chunks (Daniel Borkmann) [974936] {CVE-2013-2206}
- [scsi] qla4xxx: Update vers to 5.02.04.06.05.10-d0 for Inbox rel (Chad Dupuis) [978150]
- [scsi] qla4xxx: ISP8xxx: Correct retry of adapter initialization (Chad Dupuis) [978150]
- [scsi] qla4xxx: Fix req queue count manipulation on response path (Chad Dupuis) [978150]
- [scsi] qla4xxx: Fix targets not coming back if chap is enabled (Chad Dupuis) [978150]
- [scsi] qla4xxx: Correct early completion of pending mbox (Chad Dupuis) [978150]
- [net] fix invalid free in ip_cmsg_send() callers (Petr Matousek) [980142] {CVE-2013-2224}
- [x86_64] Early segment setup for VT (Paolo Bonzini) [978305]
- [block] cpqarray: info leak in ida_locked_ioctl() (Tomas Henzl) [971246] {CVE-2013-2147}
- [net] tcp: bind() use stronger condition for bind_conflict (Flavio Leitner) [957604]- [virt] netback: don't disconnect frontend with oversize packet (Andrew Jones) [971155]
- [virt] netfront: reduce gso_max_size to account max TCP header (Andrew Jones) [971155]
- [block] cdrom: use kzalloc() for failing hardware (Frantisek Hrbata) [973104] {CVE-2013-2164}
- [block] cciss: Update version string (Linda Knippers) [919633]- [block] cciss: Silence noisy per-device cciss messages (Tomas Henzl) [827515]
- [fs] gfs2: flush work queue before clearing glock hash tables (Abhijith DGkP@rap-walks.patch: Saturate span walks in Render,
  so we don't wrap around. (#448586)
- xorg-x11-server-1.1.1-aiglx-happy-vt-switch.patch,
  xorg-redhat-die-ugly-pattern-die-die-die.patch: Rediff for patch fuzz.- randr-source-compat.patch - backport fixes from upstream (#466987)
- xserver-1.1.1-fb24-32-fix.patch + xserver-1.1.1-ia64-memops.patch:
- Altix fixes to make nautilus + s-c-d work. (#468015)- remove 2560x1600 modes from the extra modes (#465880)- Update compat server source to 1.5.2-2.fc10. (#264821)- fix crash in traps code caused by firefox (#455359)- fix libdrm permissions (#455089)- Add Xvnc-source subpackage (#455597)- add DDC renaming to randr source code- rebase the source code for drivers to build against and add compat patches
- xserver-1.1.1-randr-fix.patch - set the -1 to 0 like upstream this fixes some randr1.2 compat output problems- xserver-1.1.1-automouse-crash-fix.patch: Fix a rare crash when starting
  under anaconda. (#249567)- xorg-x11-server-1.1.1-altix-root-bridges.patch - fix ALTIX PCI (#448139)- cve-2008-1377.patch: Record and Security Extension Input validation
- cve-2008-1379.patch: MIT-SHM extension Input Validation flaw
- cve-2008-2360.patch: Render AllocateGlyph extension Integer overflows
- cve-2008-2361.patch: Render CreateCursor extension Integer overflows
- cve-2008-2362.patch: Render Gradient extension Integer overflows- Fix regression in IA64 ROM reading from altix patch (#437943)- Fix regression in pci bus count from altix patch (#438812)- Update server compat source. (#435379)- fix spec to require newer selinux policy (#433687)- xserver-1.1.1-ia64-old-kernel-warning.patch - warn about older MCA causing
  kernels on IA64 (#432796)- cve-2007-3920.patch: gnome-screensaver loses keyboard grab when running under compiz (#357111)
- cve-2007-6429.patch: Update patch to final upstream solution (#431191)- xserver-1.1.1-acpi-ibm-events.patch - parse thinkpad ACPI hotkey video events (#249290)- Add altix pci patch (#211530).- Update some SDK headers from xserver 1.5.- Sync with zstream 1.1.1-48.26.el5_1.5:
- cve-2007-6429.patch: Fix MIT-SHM pixmaps with bpp < 8.- Fix construction of the -randr-source subpackage.- Sync with zstream 1.1.1-48.26.el5_1.4:
- cve-2007-5760.patch: XFree86-Misc Extension Invalid Array Index Vulnerability
- cve-2007-5958.patch: Xorg / XFree86 file existence disclosure vulnerability
- cve-2007-6427.patch: XInput Extension Memory Corruption Vulnerability
- cve-2007-6428.patch: TOG-CUP Extension Memory Corruption Vulnerability
- cve-2007-6429.patch: EVI and MIT-SHM Extension Integer Overflow Vulnerability- Add -randr-source subpackage for source compatibility with newer drivers.
- xserver-1.1.1-mode-bandwidth.patch: Match enums with 1.5 server.
- randr-source-compat.patch: Fix miscellaneous drift since 1.1.- xserver-1.1.1-mmap-{expansion,failure}.patch: Reinstate. (#233981)- xserver-1.1.1-enable-rgb-txt.patch: Re-enable rgb.txt modifying (#245988)- xserver-1.1.1-mmap-{expansion,failure}: Revert, required kernel changes
  not included in 5.1. (#233981)- xserver-1.1.1-acpi-tokenising-fix.patch: Also expose the builderstring
  as an exported server symbol so external drivers can notice the bugfix.
  (#246175)- xserver-1.1.1-acpi-tokenising-fix.patch: Fix a crash on ACPI lid events.
  (#246175)- xserver-1.3.0-xkb-and-loathing.patch: Ignore (not just block) SIGALRM
  around calls to Popen()/Pclose().  Fixes a hang in openoffice when
  opening menus. (#210750)- xserver-1.1.1-vbe-panelid.patch: Add VBE core call for panel information,
  so we can better handle panels with no EDID. (#237121)- xserver-1.3.0-pci-bus-count.patch: Fix cases where the VGA adaptor is
  not in the first 128 devices. (#236202)- xserver-1.1.1-aiglx-big-endian.patch: Fix texture colors on
  big-endian machines.  (#215786)- xserver-1.1.1-mmap-{expansion,failure}.patch: Fix PCI mmap() on
  some ia64 machines. (#233981)- xserver-1.1.1-int10-bsf.patch: Fix x86emu for BSF and BSR. (#227530)- xserver-1.1.1-silence-warnings.patch: Reduce several h~k @rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootspecspo-13-4.el5.centos.src.rpmconfig(specspo)specspoJJconfig(specspo)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)13-4.el5.centos3.0.4-14.0-14.4.2.3P)xP$2P"`PIEoT`E"`DN`DDj?`>[`>Z>J>H =`=w=u0=s`=d
`=R=@t=?#`=7:`=/Q`==`<O`<A<`<<M`<<{`<`<@<<`<n<~`<Q`<Q`<;`;;`;~`;v`;tY`;s;q`;q`;g*`;d`;a`;`;_A`;];X;	::ύ::;`:]::t:::p:m:l`:^,Johnny Hughes <johnny@centos.org> 13-4.el5.centosJaroslav Škarvada <jskarvad@redhat.com> - 13-4Jaroslav Škarvada <jskarvad@redhat.com> - 13-3Jaroslav Škarvada <jskarvad@redhat.com> - 13-2Martin Bacovsky <mbacovsk@redhat.com> 13-1.el5Martin Bacovsky <mbacovsky@redhat.com> 12-1Martin Bacovsky <mbacovsk@redhat.com> 11-1Jesse Keating <jkeating@redhat.com> 10-2Bill Nottingham <notting@redhat.com> 10-1Paul Gampe <pgampe@redhat.com> 9.0.92Paul Gampe <pgampe@redhat.com> 9.0-1Bill Nottingham <notting@redhat.com> 8.0.95-1Paul Gampe <pgampe@redhat.com> 8.0.94-2Paul Gampe <pgampe@redhat.com> 8.0.94-1Paul Gampe <pgampe@redhat.com> 8.0.92-1Trond Eivind Glomsrd <teg@redhat.com> 8.0-3Trond Eivind Glomsrd <teg@redhat.com> 8.0-2Trond Eivind Glomsrd <teg@redhat.com> 8.0-1Trond Eivind Glomsrd <teg@redhat.com> 7.3.94-2Trond Eivind Glomsrd <teg@redhat.com> 7.3.93-3Trond Eivind Glomsrd <teg@redhat.com> 7.3.93-2Trond Eivind Glomsrd <teg@redhat.com> 7.3.93-1Trond Eivind Glomsrd <teg@redhat.com> 7.3.92-3Trond Eivind Glomsrd <teg@redhat.com> 7.3.92-2Trond Eivind Glomsrd <teg@redhat.com> 7.3.92-1Trond Eivind Glomsrd <teg@redhat.com> 7.3.91-1Trond Eivind Glomsrd <teg@redhat.com> 7.3.90-1Trond Eivind Glomsrd <teg@redhat.com> 7.3-4Trond Eivind Glomsrd <teg@redhat.com> 7.3-3Trond Eivind Glomsrd <teg@redhat.com> 7.3-2Trond Eivind Glomsrd <teg@redhat.com> 7.3-1Trond Eivind Glomsrd <teg@redhat.com> 7.2.94-1Trond Eivind Glomsrd <teg@redhat.com> 7.2.93-3Trond Eivind Glomsrd <teg@redhat.com> 7.2.93-2Trond Eivind Glomsrd <teg@redhat.com> 7.2.93-1Trond Eivind Glomsrd <teg@redhat.com> 7.2.92-3Trond Eivind Glomsrd <teg@redhat.com> 7.2.92-2Trond Eivind Glomsrd <teg@redhat.com> 7.2.92-1Trond Eivind Glomsrd <teg@redhat.com> 7.2.91-1Trond Eivind Glomsrd <teg@redhat.com> 7.2.90-1Trond Eivind Glomsrd <teg@redhat.com> 7.2-3Trond Eivind Glomsrd <teg@redhat.com> 7.2-2Trond Eivind Glomsrd <teg@redhat.com> 7.2-1Trond Eivind Glomsrd <teg@redhat.com> 7.1.95-1Trond Eivind Glomsrd <teg@redhat.com> 7.1.95-0.1Trond Eivind Glomsrd <teg@redhat.com> 7.1.94-2Trond Eivind Glomsrd <teg@redhat.com> 7.1.94-1Trond Eivind Glomsrd <teg@redhat.com> 7.1.94-0.4Trond Eivind Glomsrd <teg@redhat.com> 7.1.94-0.3Trond Eivind Glomsrd <teg@redhat.com> 7.1.94-0.2Trond Eivind Glomsrd <teg@redhat.com> 7.1.94-0.1Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivil<
.@...n't properly in the build yesterday).
- Resolves: #247986.- Update to fix inter-module symbol references on 64-bit platforms.
- Resolves: #247986.- Update fix to pipe issue and use same logic in other place we call "head -n 1"
- just in case it would ever also cause similarly noisy output.
- Resolves: #249537.- Overhaul logic for bootpath driver handling to work with new-kernel-pkg
  grubby better in keeping with their design.
- Resolves: #252210.- Fix a silly noisy message generated by a break in a pipe calling rpmsort.
- Resolves: #249537.- Revert making updated grub entry default.
- Related: #224076.- Make naming of Driver Update Program grub entry more friendly to RHEL users than the previous entries were.
- Make the resultant grub entry default bootable.
- Related: #224076.- Force loading of lcs on loading of cu3088.
- Fix patch ordering.
- Resolves: #236097.- Forwardport insmod patch from RHEL4.5.
- Cleanup old initrd images on kernel removal.- Update weak-modules script.
- Resolves: #229512.- Display module signing key via new module_sig option.
- Resolves: #224596.- Load sg on st load.
- Related: #225073.- Modinfo support for multiple kernels (needed for mkinitrd).
- Related: #224076.- Remove additional trailing '/' on IA64 initrd path.
- Resolves: #228789.- Detect Xen kernels and modify grub update accordingly.
- Resolves: #222135.- Prevent modifying existing grub entries (always add them).
- Don't ask for new entries to be default by default.
- Resolves: #222085, #222084.- Clean temporary initrds if identical to existing one(s).
- Resolves: #144378.- Handle the alternative location for initrd on IA64 boxen.
- Resolves: #215432.- Don't create compatibility links from a kernel into itself.
- Resolves: #215857.- Modify weak-modules to handle kmod removal and the need to create
  compatible kernel module links to other compatible modules.
- Resolves: #215272.- Modify weak-modules to handle module removal against multiple kABI compat.
  kernels at the same time, removing the correct module links.
- Resolves: #216645.- Modify weak-modules to handle single item rpmlists properly.
- Resolves: #215309.- Don't run mkinitrd and add grub.conf for kernels being removed
  in weak-modules (#214692).- BZ213966 fix to run mkinitrd properly and add new grub entries.- BZ205510 fix causes BZ211519 because mkinitrd mistakenly parses the m-i-t
  output including preloading commands. Reverting this patch for now.- Fixes against BZ205510.- Updated to upstream with some miscellaneous fixes from contrib.
- Rebuilt allconf patch since retabbed upstream source.- Updated to upstream with new module priority/override features.
- Documentation updates and other miscellaneous fixes.- Build in a shell version of rpmsort to avoid unnecessary dep.- Add pre-req for /usr/lib/rpm/redhat/rpmsort- Reverted back to script based weak-updates to avoid python dep.- Don't call depmod on removing a kernel.
- Warn rather than exit if we can't process weak-updates on new kernel
- Handle duplicate modules by picking the latter version of the two.- Don't call mkinitrd when removing a kernel.- New weak-modules with fixes- rebuild- updated patch for weak-modules- added patches for weak modules- Rebuild to pick up new nosegneg libc.a for insmod.static- version 3.3-pre1
- added blacklist-compat and ghosted empty /etc/modprobe.conf.dist- version 3.2.2- rebump for build order issues during double-long bump- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- ghost /etc/modprobe.conf (#130603)- rebuilt- update to 3.2pre9- don't escape '-' in module names for module.alias- fix depmod segfault on bad modules (#162716)- update to 3.2-pre7
- put modprobe.conf.dist in /etc/modprobe.d- load snd-seq-device/snd-seq-oss on load of pcm devices (part of #147637)- buildreq: docbook-utils (#151070)- update to 3.1 final- don't use dietlibc on x86 anymore- add rule for emu10k1 synth (#133280)- fix segfault (#131441)- update to 3.1-pre5- more modprobe.conf.distko@8,@,,,AAAAAAAAAAAABlibuser.conflchfnlchshlibuserlibuser.so.1libuser.so.1.1.6libuser_files.solibuser_ldap.solibuser_shadow.solibusermodule.solchagelgroupaddlgroupdellgroupmodlidlnewuserslpasswdluseraddluserdellusermodlibuser-0.54.7AUTHORSCOPYINGNEWSREADMETODOattributes.txtmodules.txtrfc2307.txtlibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molibuser.molchage.1.gzlchfn.1.gzlchsh.1.gzlgroupadd.1.gzlgroupdel.1.gzlgroupmod.1.gzlid.1.gzlnewusers.1.gzlpasswd.1.gzluseradd.1.gzluserdel.1.gzlusermod.1.gzlibuser.conf.5.gz/etc//usr/bin//usr/lib64//usr/lib64/libuser//usr/lib64/python2.4/site-packages//usr/sbin//usr/share/doc//usr/share/doc/libuser-0.54.7//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cy/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/hy/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ku/LC_MESSAGES//usr/share/locale/lo/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/my/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/no/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@Latn/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/ur/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuk@PePpPqO#D],D],D]cD],PqPcPcPhPdPhPhPhPhPdPdPdPcPcPhPdPhPhPhPhPdPdPdPcPhPdPhPhPhPhPcPcPcPcPcPcPhPdPhPhPhPhPdPdPdPcPcPhPdPhPhPhPhPdPdPdPcPhPdPhPhPhPhPdPdPdPcPgPhPgPgPhPePcPcPcPhPdPhPhPhPhPdPdPdPcPcPhPdPhPhPhPhPdPdPdPcPiPdPiPiPiPiPdPdPdPcPcPiPdPiPiPiPiPdPdPdPcPcPiPdPiPiPiPiPdPdPdPcPbPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPbPePbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPePbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPcPbPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPbPbPcPbPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPbPePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePeEkP@ Høgsberg <krh@redhat.com> 1.0.99.901-3Kristian Høgsberg <krh@redhat.com> 1.0.99.901-2Adam Jackson <ajackson@redhat.com> 1.0.99.901-1Adam Jackson <ajax@redhat.com> 1.0.99.2-2Kristian Høgsberg <krh@redhat.com> 1.0.99.2-1Kristian Høgsberg <krh@redhat.com>Soren Sandmann <sandmann@redhat.com> 1.0.99.1-2Kristian Høgsberg <krh@redhat.com> 1.0.99.1-1Jeremy Katz <katzj@redhat.com> 1.0.1-8Jeremy Katz <katzj@redhat.com> 1.0.1-7Mike A. Harris <mharris@redhat.com>Jesse Keating <jkeating@redhat.com> 1.0.1-6.1Mike A. Harris <mharris@redhat.com> 1.0.1-6Mike A. Harris <mharris@redhat.com> 1.0.1-5Mike A. Harris <mharris@redhat.com> 1.0.1-4Mike A. Harris <mharris@redhat.com> 1.0.1-3Mike A. Harris <mharris@redhat.com> 1.0.1-2Mike A. Harris <mharris@redhat.com> 1.0.1-1Mike A. Harris <mharris@redhat.com> 1.0.0-3Mike A. Harris <mharris@redhat.com> 1.0.0-2Mike A. Harris <mharris@redhat.com> 1.0.0-1Kristian Høgsberg <krh@redhat.com>Mike A. Harris <mharris@redhat.com> 0.99.2-9Mike A. Harris <mharris@redhat.com> 0.99.2-8Mike A. Harris <mharris@redhat.com> 0.99.2-7Mike A. Harris <mharris@redhat.com> 0.99.2-6Jeremy Katz <katzj@redhat.com> 0.99.3-5Mike A. Harris <mharris@redhat.com> 0.99.2-4Jeremy Katz <katzj@redhat.com> 0.99.3-3Jeremy Katz <katzj@redhat.com> 0.99.3-2Mike A. Harris <mharris@redhat.com> 0.99.3-1Mike A. Harris <mharris@redhat.com> 0.99.2-4Mike A. Harris <mharris@redhat.com> 0.99.2-3Mike A. Harris <mharris@redhat.com> 0.99.2-2Mike A. Harris <mharris@redhat.com> 0.99.2-1Mike A. Harris <mharris@redhat.com> 0.99.1-2.cvs20050830.2Mike A. Harris <mharris@redhat.com> 0.99.1-2.cvs20050830.1Kristian Hogsberg <krh@redhat.com> 0.99.1-2.cvs20050830Mike A. Harris <mharris@redhat.com> 0.99.1-2.cvs20050825.0Kristian Hogsberg <krh@redhat.com> 0.99.1-1- Roll in CentOS Branding- CVE-2014-8091 denial of service due to unchecked malloc in client
  authentication (#1168680)
- CVE-2014-8092 integer overflow in X11 core protocol requests when
  calculating memory needs for requests (#1168684)
- CVE-2014-8097 out of bounds access due to not validating length or offset
  values in DBE extension (#1168705)
- CVE-2014-8095 out of bounds access due to not validating length or offset
  values in XInput extension (#1168694)
- CVE-2014-8096 out of bounds access due to not validating length or offset
  values in XC-MISC extension(#1168700)
- CVE-2014-8099 out of bounds access due to not validating length or offset
  values in XVideo extension (#1168710)
- CVE-2014-8100 out of bounds access due to not validating length or offset
  values in Render extension (#1168711)
- CVE-2014-8102 out of bounds access due to not validating length or offset
  values in XFixes extension (#1168714)
- CVE-2014-8101 out of bounds access due to not validating length or offset
  values in RandR extension (#1168713)
- CVE-2014-8093 xorg-x11-server: integer overflow in GLX extension requests
  when calculating memory needs for requests (#1168688)
- CVE-2014-8098 xorg-x11-server: out of bounds access due to not validating
  length or offset values in GLX extension (#1168707)- xserver-1.1.1-randr-config-timestamps.patch: Backport timestamp comparison
  fix from upstream RANDR code (#1006076)- CVE-2013-6424: Fix OOB in trapezoid rasterization- CVE-2013-4396: Fix use-after free in ImageText requests (#1014561)- xserver-1.1.1-more-regen-leaks.patch: Fix a crash on exit in XKB (#960950)- xserver-1.1.1-more-regen-leaks.patch: Cope with root cursor refcounting
  being differently broken in different DDXes. (#498357)- xserver-1.1.1-x86emu-1.13.patch: Revert, regresses some G200SE (#858014)- xserver-1.1.1-more-regen-leaks.patch: Plug yet another leak, this time in
  Xinerama. (#498357)- xserver-1.1.1-x86emu-1.13.patch: Sync x86emu bugfixes with upstream
  xserver. (#858014)
- xserver-1.1.1-xkb-width-fix.patch: Fix a crash in XKB keymap resize
  across different RHELs. (#822438)- fix prgn free to use correct api (#854634)- xserver-1.1.1-more-regen-leaks.patch: Fix memory leaks at regeneration in
  XKB, root cursor, and4k0w@Hp?rd$	(	E$	6J`fp	
@
$   (+84	9X	:<	BFGH4IXYZ[\]D^wbd5e:f?kAlHt`uv0w@xy{XAA
DHdghhlCsamba-client3.0.333.41.el5_11Samba (SMB) client programs.The samba-client package provides some SMB clients to compliment the
built-in SMB filesystem in Linux. These clients allow access of SMB
shares and printing to SMB printers.W
=Ubuilder17.centos.org7CentOS-5CentOSGNU GPL Version 2Applications/Systemhttp://www.samba.org/linuxx86_64@2Ǩ$#7h"X "jX.<	'w܁큤W
=?W
=?W
=>W
=W
=>W
=>W
=>W
=>W
=>W
=W
=>W
=W
=>W
=?W
=W
=W
=W
=W
=W
=W
=W
=W
=W
=W
=W
=b931139a3043641569bc71a81ab312fae937cf6c80d8d33d9fdb95b0cb823695e0426eae6f35c5c7ff7e98c35821eb3ad9dd28a3d52f64f7509d6fe73280fdaecd9e3d761f70c51b246cf4e6ba03fe98da171a5cef53a5f18555e13dc8185036406d6fedcb409e47f0f4a4cb65a5e7514e30149945cdd6af74c4c4b8f4488e4c1bf8bd31ab4e05bd14c72dc555730f0849e63794110e4e2ad691941774b5e9051813bb1ddf8241113399809434580cb0c030651d97e1c897941f2b0c12a285bf1efc3f557fdfe2aff17f8858e0d1cc0323454512839914cd43875bf7474e505cf42b8450f86971a6ba5afbd6035571aa1b258add5c6e2f910137890b5e422fb29d45e1ad5c3729e20376e563c2f35f0918324122938c74c570e175b6a58c10a8a638ae43661bbfc5e7bd75d60a25bc2e5ab7ee898e2f118605e5e723b761867d964323ef102c0853014abc03455eb1115ef23923171edf34fb3dbd918eb868ee0013a21f94c70c110307d281b0479bd40b9fe71834dd0308c5d9edf83011a4054292c5a7a8bc19d4f49dfe1f8a78b37d68d39a68310aa386eb9426f3acdae94erootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsamba-3.0.33-3.41.el5_11.src.rpmsamba-client@@@@@@@@@@@@@@@@@@@@@@@@@@@@JJ@/bin/sh/usr/bin/perllibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgssapi_krb5.so.2()(64bit)libgssapi_krb5.so.2(gssapi_krb5_2_MIT)(64bit)libk5crypto.so.3()(64bit)libk5crypto.so.3(k5crypto_3_MIT)(64bit)libkeyutils.so.1()(64bit)libkeyutils.so.1(KEYUTILS_0.3)(64bit)libkrb5.so.3()(64bit)libkrb5.so.3(krb5_3_MIT)(64bit)liblber-2.3.so.0()(64bit)libldap-2.3.so.0()(64bit)libncurses.so.5()(64bit)libnsl.so.1()(64bit)libnsl.so.1(GLIBC_2.2.5)(64bit)libpopt.so.0()(64bit)libreadline.so.5()(64bit)libre"kA@3738393:3;3<3=3>3?3@3A3B3C3D3E3F3G3H3I3J3K3L3M3N33V3T3h3i3j3k3l3m3n3o3q3y3z3{3|3}3~3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333[333#333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333	3
333
3333333333333333333 3!3"333Z333h3 3!3"3#3$3%3&3'3(3)3*3+3,3-3.3/303132333435363738393:3;3<3=3>3?3@3A3B3C3D3E3F3G3H3I3J3K3L3M3N3O3P3Q3R3S3T3U3V3W3X3Y3Z3[3\3]3^3_3`3a3b3c3d3e3f3g34\4o4p4q4r4s4t4u4v4w4x4y4z4{4|4}4~44444444444444444444444444444444444444444[4444444444444444444444444444444444444444444444444444	4
444
4444444444444444444 4!4"4#4$4%4&4'4(4)4*4+4,4-4.4/404142434445464748494:4;4<4=4>4?4@4A4B4C4D4E4F4G4H4I4J4K4L4M4N4O4P4Q4R4S4T4U4V4W4X4Y4Z4[4\4]4^4_4`4a4b4c4d4e4f4g4h4i4j4k4l4m4n444444444444444444444444444444444444444
4	444
4444444444444444444 4$4"4!4#3333^333333333333W33	3
333
3333333333333333333 3!3"3#3$3%3&3'3(33`3x3r3u3s3v3t3w3y3z33Y3;33<3=3>3?3@3A3B3C3D3E3F3G3H3I3J3K3L3M3N3O3P3Q3R3S3T3U3V3W3X3Y3Z3[3\3]3^3_3`3a3b3c3d3e3f3g3h3i3j3k3l3m3n3o3p3q3r3s3t3u3v3w3x3y3z3{3|3}3~3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333	3
333
3333333333333333333 3!3"3#3$3%3&3'3(3)3*3+3,3-3.3/303132333435363738393:3;3<3=3>3?3@3A3B3C3D3E3F3G3H3I3J3K3L3M3N3O3P3Q3R3S3T3U3V3W3X3Y3Z3[3\3]3^3_3k0E-@--- the loopback device
  instead of all devices.
- do not include check.tar with old anti-spam rules- fix configuration of /etc/aliases- fix interoperation problems with communigate pro
- disable msa- update to (security release) 8.11.2
- build also on RHL 6.x #16061
- include smrsh man-page #17901
- use the "-f" flag for makemap to preserve case for virtusertable
  and userdb in /etc/mail/Makefile - suggested by Harald Hoyer
- fix /usr/doc -> usr/share/doc in docu #20611
- wrong path in sendmail.mc #20691
- tcp-wrapper support wasn't enabled correctly #21642
- do not expose user "root" when masquerading like in older releases #21643
- disable the VRFY and EXPN smtp commands #21801
- disable queue-runs for normal users (restrictqrun privacy flag)
- fix typo in sendmail.mc #21880, #22682
- disable daemon mode to see what needs fixing- update to 8.11.1- rebuild in new environment- apply fixes for LDAP maps being closed too soon- provide /usr/lib/sasl/Sendmail.conf so that people know we can use it (#16064)- enable listening on the smtp port again- fix "missing find_m4.sh" problem by defining M4=/usr/bin/m4 (#14767)- okay, enable LDAP support again
- enable SMTP auth support via Cyrus SASL- disable the LDAP support until we can remove the sendmail->OpenLDAP->perl dep
- fix prereq- update to sendmail 8.11.0
- add LDAP support- move initscript back- automatic rebuild- require procmail
- add further aliases- prereq init.d
- fix typo- ignore error from useradd- FHS fixes
- /etc/rc.d/init.d -> /etc/init.d
- fix initscript- change to /usr/share/man- turn off daemon behaviour by default- rebuild, fix dependencies- prereq /usr/sbin/useradd- enable MAP_REGEX
- enable tcp_wrapper support- fix etc/mail/aliases -> /etc/aliases in sendmail-redhat.mc- update to 8.10.1
- fix build without sendmail installed
- add 'mailnull' user- update to 8.10.0
- remove compatiblity chkconfig links
- add a mailnull user for sendmail to use- break the hard link for makemap and create it as a symlnk (#8223)- Fix location of mailertable (Bug #6035)- fixes for non-root builds (#8178)- change perms on /etc/sysconfig/sendmail from 0755 to 0644
- allow compressed man-pages- add patch to prevent the DoS when rebuilding aliases- install man pages, not groff output (#3746).
- use dnl not '#' in m4 comment (#3749).
- add FEATURE(mailtertable) to the config -- example file needs this (#4649).
- use db2 not db1.- add 127.0.0.1 to /etc/mail/access to avoid IDENT: relay problem (#3178).- chkconfig --del in preun, not postun (#3982)- initscript munging- fixed typo bug in comment in the default .mc file (#2812)- fox the awk scripts in the postinstall
- enable FEATURE(accept_unresolvable_domains) by default to make laptop
  users happy.- make the redhat.mc be a separate source files. Sanitize patches that used
  to touch it.
- install redhat.mc as /etc/sendmail.mc so that people can easily modify
  their sendmail.cf configurations.- fixed virtusertable patch
- make smrsh look into /etc/smrsh- remove noreplace attr from sednmail.cf.- provide a more sane /etc/mail/access default config file
- use makemap to initializa the empty databases, not touch
- added a small, but helpful /etc/mail/Makefile- correxct dangling symlinks.
- check for map file existence in %post.- auto rebuild in the new build environment (release 3)- improved 8.9.3 config from Mike McHenry <mmchen@minn.net>- version 8.9.3- build for 6.0
- use the libdb1 stuff correctly- Allow empty QUEUE in /etc/sysconfig/sendmail for those who
  want to run sendmail in daemon mode without processing the
  queue regularly.- /etc/sysconfig/sendmail- recompile statically linked binary for 5.2/sparc- translations modified for de, fr, tr- enhanced initscripts- added a rmail patch- argh!  Fixed some of the db1 handling that had to be added for glibc 2.1- added support for db1 on SPARC- added chkconfig support
- various spec file cleanups
- changed group to Networking/Daemons (from Daemons).  Sure, it runs on
  non networked systems, but who really  k@nto a file, no need to keep them 
  in the rpm database- bump epoch, the buildsystem thinks 7.0.000-2 is older than 7.0.g001-1
  although rpm is quite happy with it.- vim-7.0 
- Spell checking support for about 50 languages
- Intelligent completion for C, HTML, Ruby, Python, PHP, etc.
- Tab pages, each containing multiple windows
- Undo branches: never accidentally lose text again
- Vim script supports Lists and Dictionaries (similar to Python)
- Vim script profiling
- Improved Unicode support
- Highlighting of cursor line, cursor column and matching braces
- Translated manual pages support.
- Internal grep; works on all platforms, searches compressed files
- Browsing remote directories, zip and tar archives
- Printing multi-byte text
- find details about the changes since vim-6.4 with :help version7

- fix SE Linux context of temporary (.swp) files (#189968)
- /bin/vi /vim-minimal is now using /etc/virc to avoid .rpmnew files
  when updating- vim-7.0g BETA- vim-7.0f3 BETA- vim-7.0e BETA- vim-7.0d BETA- fix vimrc filename- new snapshot- vim-7.0c BETA- Rawhide build as vim, opposed to vim7 (prerelease)
- conflict with older man-pages-{it,fr} packages
- cleanup lang stuff- make it coexist with vim-6 (temporarily)
- new CVS snapshot- vim7 pre Release
- older changelogs available in Changelog.rpmvim7-commonbuilder17.centos.org 1357706986k@z@J?:d
 	$	^,0HLU\	ez	%,
0G
Ld0BM M<dTdtdeeee(f8f79f7:pn7B~F~"G~DH\ItXYZ0[4\8]P^_bVdefkltu3vJ,$wOxf0y}H{}tLP`AA
ghCvim-common7.0.1097.2.el5The common files needed by any version of the VIM editor.VIM (VIsual editor iMproved) is an updated and improved version of the
vi editor.  Vi was the first real screen-based editor for UNIX, and is
still very popular.  VIM improves on vi by adding new features:
multiple windows, multi-level undo, block highlighting and more.  The
vim-common package contains files which every VIM binary will need in
order to run.

If you are installing vim-enhanced or vim-X11, you'll also need
to install the vim-common package.Pbuilder17.centos.orgCentOS-5CentOSfreewareApplications/Editorslinuxx86_643i-jmB<UCJB<&Wwh%wsgs[?@^i'"{RM9Tc*7BtGW"r	*:	0~

$	_
		

q
	s[0t"}I
PY
emw&zmD=qP8	 7Q,X`;S&	(0$/W	x%6Kl]8
JQ
)1;(A	a;1nJD(AhDY5J+2IPuL
3%0
9P&VW+6Z8x)
OW qi}(kLJQo
wy s!_h
&F1%8<^6wnӤe
_#Xbj<w[ GG8[\cXu]&UTZR[d#
o|,T[a]caSS,[e{J#|hU(1#ZQ8\m7ar	`j_X<qUf]pm`~|>b_nWX[YSds
lT[[NyyQ-/g	$"ZEL
=(G./D
fcc&1yFckd
@ufor sparc baud rates > 38400.- fix postun script so that we don't remove ourselves on every update
  doh...
- add a trigger to fix old versions of the package- rebuild to fix dependencies- update to 3.0.7.
- source /etc/profile so that USER gets set correctly (#5655).- source /etc/profile.d/*.sh in zprofile- fix zshenv and zprofile scripts - foxed versions from HJLu.- clean up init files some. (#4055)- Make sure that env variable TmpFile is evaluated. (#2898)- fix select timeval initialization (#2688).- auto rebuild in the new build environment (release 10)
- fix the texi source
- patch to detect & link against nsl- use mktemp to handle temporary files.- fixed bug #365- build for glibc 2.1- compile for 5.2- translations modified for de- Eliminate incorrect info page removal.- translations modified for de, fr, tr- manhattan build
- moved profile.d handling from zshrc to zprofile- Upgraded to 3.0.5
- Install-info handling- built against glibc- Upgraded to 3.0.2
- Added 'reasonable' default startup files in /etc/bin/sh/bin/sh/bin/shbuilder17.centos.org 1434628531/h/r/s/n/o/q/p/m////[/C/?/V/=/\/@/H//D/P/ /:/>/B/;/G/</A/T/*/(/"/R/,/%/O/!/E//////// //"/!/#/i/g/]/j/k/c/X/Y/d/W/\/^/_/a/[/b/e/Z/`//^/`/b/////'/1/ /</////!///////=/@///(////kp$@ebcdb9534e635eab20f1a1f4bcb339ffe788300571468a4af7fdc93a6ef85dd1c051a79c37a099c161d17cc1e2e5fb5f7a21aeb22f7de6cb18738d5b404c50174d2ee8c14d594646773882d1232278f1ae2257ff3d8753e3f2db574350206270a7737cca6609fa7043901d4ad4bcdfc1b97f7e1c868f6632c7654bb77b9f652605d3de6b09173fc0fe5dd4586e87f1f842d84a35658b64b985324fd28ec817128176dbe3c5d3b157499224c606baf8d281a468a3d39a9399f17716ddf1969891699e4dcb9f36402f981acd95a85170724564ec47f455eec190f6c2ad2841433fde5a1b85b51db1275090d746a8048a15ab921a0f1a5f087a82663d65d90a4daa42efa99eeec7770924a9a3aae51cf579701d6adf53707e8588ec55a9a639daa9d3de8d78349af09115d94e573b380e73882dc4b8bbfc527b8c4c9a18aad0ca70c97200a77732ed90c6c5281ea092330610b916eec1907c93544f5ca158f320755a0a9a2316ee8d6c64697195f49c1f3aac93221d43c7457b358e91c0216c0cad51fafa0506231d63150a78e256f87a156713ff3e549b067123f5c9d2a6238931020e041ecc66ce0652d4272a7d9083dd546ea136b96f1004e266e2c5030e3918d2f008c11e92df47b8695de0746ef864a531f7dd3861be80511cfceb019fe9a009c1279c9580dfa5990aa738e2fbd044808aeb361273c424ef2788d0249c4ab253ac2f63ee500c74669da2d7a6bcf9d5830d4d2d0ca292f5b3ce10282cb5787104d4c6d85aaacf8a9d30b23598e5e80da9583ba7e87371fce165c49ce2a1e9b9391703799e9c36031eec9d03a1cd22477ccb516459f85e65ba5634d833e3f39a4b97f08d1ef642a6aa689c78350fc30e85c24d39c6c33e4889e41dd4921a8c37151a48bb8a21eb58ee52e92433ffa3e22f5ab253086692f1dc02720ebb41f3e9db3d9b52116f0d87a8b49cfa0cc4496eaa1ec2ffa31eeaf3e1b1f9246c52921e8b81cb500658375e5701c3e8706ee6f94c78b1584a01de6d97f8d5422c081936dfce8de5f49e5c6d3edfeade09a8192ea2ac07d210272f374123535ec5dde257dced3dd37b8ab8e28ae7511d6fdd09c208564303744bc5eb6bd597f883b3cc46ae9c3fe841b2602d478ad9d332be171c5b4d442151a6f1109294a3d3f3a9a2b237949d249421c1eb00d1570d55257950170189349135e29ec68c1e15a980a36850bad480de07f027a44cc3e3a3067cc56086d820a73af8abc6234e49e9e4763288ff101464d32a81447b131135fc4a11f0159b17f2240c20a696c292dddfc3be1c9b3624c3bba21f30dc9507d87eb4d6e6b6df95a19da6a7f72afed9f70a9b530403d9d407957e698c92eb095ae2e0fb4ae5dc70da99ea8603ba23afef9778c897fa22888a950d25561b3ce42b6a34eff7467b46484d6d3b7bdee7f26f140105af1454d67aaa13839dac8a78304e0e156f52ebbc4981b1a3f989f5eb573879b8c6fb5bf59391100d5fbd63ddfeaafcf70b129c0771001d46c58b424a61996611d5b89ec4fab0f640dd70e8e83f860f8d58f682453726898f3b4aa17175b387c3096b48c5758e458fb3800e5e2166ca460b58e55120ed37608da620c63e4806added1dec286a361bf044006e82360bc963ee74302ee1316facc0634c1f5d0cbd3d83c4c523be283c0d3e888a65dd53bd2a99abfc594c033aad21d536009aff8d06841ede0f9df69d7027c9970800c1f63989f4eb0076d730223ad9db41f85bcdea0bc2b92d668c13ac887f04f7703d6a07b474137cfe145997f3a04c1ae49a37e6768a55f260beb1fc6e73ab1bef138bae4a06f7f61f1287632014fa6bcc148f4a44e05695d25c114a0fa095724b2d52a4ca4d953cbbc3eac343efe91eb395cb0e07b3204a00ea798bb417e4e1f647e5568ec422075ba49c972ff6db5a10e2f86f0d576f95edbfbb2770bccaebf97dfa6cfcf843861c5210d9cf8ae2c1b85bb3cf68acfd1bddf910718d6ed9b9c831bcaee8259b3ff98a3d07ccaf5cdf4d2a69d8bdf88c12d500ee4406384162e0d9824d9bf5d7bb389059552754f943d83184cc0faeb3d77d11e751d6fa6c32778e16b58546ea481a9f06da7b897cced07df283f9c4be6c28710bb0507e37b9cc79a85919b55be881263344578cfbaca68f785d80b60310d48741df04eb039166afb69e5711076750c9fad5f41db0e90590b9a82d5e8275191e33aa08804c9dfa4d9b56d142b14aea26a376ac197c60f2870c5a0c6ba5bf305eb607a8cf902ed0081f5de26f23ee669685ad61fa3f64ba4410ea64531106485a42a64af855c63cf7695e0fc4f06a405c127b81af244410fb91cc5528386f1d940f1c2914ece7b51f7e7b9e33f041dfc2e9e1e0ecb928edeed64bb7ea02eb1890a806d1e96ac9ab7bed1db0bf616d8b1a84203237533b2209066a2e6f6577b5368cb02926f57193a3430dcc8e8c6f8671bbc1d68ac67e791985f17c4a1f0be66c903834057e88e472eab94b422fcb8a22df70bdb2ef80aab61919ca529753a994c12bf866db143b2997124409bf60ed12e3147fd01d9420a1ea558d35f1e32f9443a15b5c453873069dfb352362764e3812edfd2f39e1a01c972d86bad68ad6e13c542a614c6214c8fab74680bd9655eb8ba209ec34bfeeb5fe89a7b1ba6c9963e33cdf2bac7c8b65bad4050f23bcfeb1493f8b1c378fb1103998576aee2c54ad8d0bb5b08d13287b3553343f02e8b811b1b98c92f0a0facddb3b9cbf7695053e059f55f20398d1b75ec3373e2c4f35i\
0=@s in autoconf to allow bulk uuid generation- New uuidd subpackage for unique time-based UUID generation (#233471)
- Fix potential uninitialized reference in e2fsck (#428707)- Fix integer overflows (#414651 / CVE-2007-5497)- e2fsck: Check all journal blocks for validity (#241222)
- wrap a couple headers to fix multilib issues (#270441)- Fix up .po files to remove timestamps; multilib issues (#245653)- Many coverity-found potential leaks, segfaults, etc (#239354)
- Fix debugfs segfaults when no fs open (#208416, #209330)
- Avoid recursive loops in logdump due to symlinks in /dev (#210371)
- Don't write changes to the backup superblocks by default (#229561)
- Correct byteswapping for fast symlinks with xattrs (#232663)
- e2fsck: added sanity check for xattr validation (#230193)- Prefer the labels that dosfsutils writes, rather than various other kinds of
  labels on FAT/VFAT
  Related: rhbz#218957- make uuid_generate_time generate unique uuids
  Resolves: rhbz#218606- 32-bit 16T fixups from esandeen (#202807)
- Update summaries and descriptions- Fix problem with empty FAT label (#206656)- Fix memory leak in device probing.- fixed multilib devel conflicts (#192665)- prevent libblkid returning /dev/dm-X- rebuild- add GFS abd GFS2 support to libblkid- new version 1.39
- dropped ext2online, because resize2fs is now able to do online resize
- spec file cleanup
- enabled checks for build- prevent libblkid returning /dev/dm-X
- fix build- prevent error messages to stderr caused by libblkid calling libdevmapper- used upstream version of the blkid-epoch patch (by Theodore Tso, #182188)- Move /etc/blkid.tab to /etc/blkid/blkid.tab- BuildRequires pkgconfig- Disable /etc/blkid.tab caching if time is set before epoch (#182188)- _don't_ handle selinux context on blkid.tab, dwalsh says this is a no-no.- handle selinux context on blkid.tab- BuildRequires: gettext-devel- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- cleanup device-mapper patch
- use pkg-config for device-mapper- fix some more minor logic errors in dm probing- fix a logic error in dm probing
- add priority group for dm devices, so they'll be preferred- added support for device-mapper devices- rebuilt- fixed file conflicts between 32bit and 64bit packages (#168815)
- fixed mklost+found crashes with buffer overflow (#157773)
  Thanks to Arjan van de Ven for the patch- splitted up libs from main package, into a new e2fsprogs-libs package
- fixed requires and prereqs- new version 1.38
- Close File descriptor for unregognized devices (#159878)
  Thanks to David Milburn for the patch.
  Merged from RHEL-4
- enable tune2fs to set and clear feature resize_inode (#167816)
- removed outdated information from ext2online man page (#164383)- fix swsuspend partition detection (#165863)
- fix revalidate from ext2 to ext3 (#162927)
- fix vfat without magic detection (#161873)- added libblkid.so to devel package- fix cramfs detection bug in libblkid- upstream fixes 1.1589, 1.1590 and 1.1591:
- add include of stdlib.h to fix a core dump bug on IA64
- ignore environment variables in blkid and ext2fs for setuid and setguid
  programs
- no LOW_DTIME checks if the superblock last mount time looks insane- new version 1.37
- dropped upstream merged getsize-wrap patch- Fix the getsize-wrap patch for >4TB filesystems- Re-enable resize2fs
- Add bigendian byte-swapping fix when growing the gdt table- Fix for >=4TB devices- Update to e2fsprogs-1.36- rebuild- Disable offline resize for now: resize2fs is incompatible with
  online resize, and can result in corrupt filesystems.- More byte-order fixes for mke2fs and ext2online
- Disable fallback to old-style resize if new kernel resize code is not
  available- Fix mke2fs's creation of the resize inode on bigendian hosts- fixed macroname in changelog (#135413)
- small enhancement of progress patch- rebuilt- extended "-C" option of fsck to pass the file descriptor to the checker
  (#132543)- fixed double free in resize2fs (#132707)- Adk	
@gle process, observe as wackiness ensues)- rebuild against db4-devel- require db3-devel at build-time, not db3 (#49544)- don't include copies of the shared libraries with the soname for their names- rebuild in new environment- don't own /var/db, the filesystem package does- require make (#27313)
- add the docs to the package- update to 2.2- separate from db3/sbin/ldconfig/sbin/ldconfignss_db-compatbuilder17.centos.org 1420452610//////////////2.2-38.el5_112.2-38.el5_11libnss_db-2.2.solibnss_db.so.2makedblibnss_db.sonss_db-2.2AUTHORSCOPYINGCOPYING.LIBChangeLogNEWSREADMETHANKSdb-getent-MakefileMakefile/lib//usr/bin//usr/lib//usr/share/doc//usr/share/doc/nss_db-2.2//var/db/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII English textASCII textELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectorysymbolic link to `../../lib/libnss_db.so.2'symbolic link to `libnss_db-2.2.so'
	PPRRRRR	R
RRRRR
RRRR	R
RRRRR
?G&65t6gZ?TxGV(hk-`jxE!nm}jZY\҃7|jЈ?TxGV(
EBt+zZ&'kL"49!}f83017b4b46cb049a0b9690bc91bede850b0a23d\=
1 \<3163eae4445141c2897916750a81adc008b14adc577bc0cecaaa451647dc7edea7516ab7013c57b159ff150e4c950c76e1a408fb40db9898d13f9acb7284efc141d486128ab14c9ee3f7764055bf97fa2423bb014567eebe4fe1d848d02e44c824c70270b0753ddd442d943be3d27686b45b689a72052a3b96c7f5bec567dd425495e3fa0b7f6b0b0d65073c0c3a49d6b9c84a83b7eabf179c3e9ad7b1c98ebddaeefecff62f20e70d5a71d110cefa9c0b2cfecff62f20e70d5a71d110cefa9c0b2cf685dbb69170414d929068c530e65f1d9b6bacacc82f7403bde49a29905a9ee08e2f48191ce5072a3428b94c70b8c8ef4a24a2449fa585516167320d21ffc2c56c65318549f1b81c4cbafd720aa3af69b1c85f382c2bb2531645a6c4974d5388c58ff5e5d3abf2fa1bab5683a3421d4be4652a15db86d77bdcb8747c80160bbcbbbdeeb94eae73f9069a5609aa0058598e2e3aca20d370421b7fd94c1d0f97389a10ff21f2279305406b699dfe51ff9412ecc44492fadf4fc92ca0f2917f51d9d58a355d5c0f452a413d28ff20a2b344f4048c8e6fd345cff6c6bd5407783654d11cc2dc41b22b24e2f7c37dfe46fc688a9462ae9d7b392dc475590c34bce157dab9e2d6171cd7d6e715aad2638e4a25f728d843122439113b0636a9cabd3d146e1029906ed195bd46bb98781d4e9f9d0103970c9b89708d05928670dcbe5781be5de70624103c690c9bfc60b51b83598d976818ab6fea027fc1f65f4c79a5363e50f01e2271c5d09d830cc91136f34aac3606243f8a55ff04f400c70d05033e8008b964af487f6787dff76821e0a35881a056ab5c3ae5e65775fb3f7d8d13dc0f5115cc714b4048e1a8a81d896a0f26cf051eb9f96e8223e6c1e5f7e67a8e5bff8bc1b2ebe276b307ed458a1e5ab21467bb25691795e04d14efb11437f9e1b30libvorbis.so.0.3.1libvorbisenc.so.2.0.2libvorbisfile.so.3.1.1MjH
@Z (Stefan Assmann) [839633]
- [net] e1000e: fix test for PHY accessible on 82577/8/9 and I217 (Dean Nelson) [838624]- [fs] gfs2: Use mempool for fake buffer heads in log flushing (Abhijith Das) [807723]
- [fs] gfs2: Sort ordered write list (Abhijith Das) [800509]
- [fs] gfs2: speed up glock dump (Abhijith Das) [773020]
- [net] cxgb4: firmware update to 1.4.23.0 upstream (Jay Fenlason) [802614]
- [mm] NULL pointer dereference in __vm_enough_memory (Jerome Marchand) [836244]- [net] introduce build_skb() (Michal Schmidt) [837083]
- [net] fix conflict between null_or_orig and null_or_bond (Veaceslav Falico) [809686]
- [virt] blkback: Don't disconnect until state XenbusStateClosed. (Miroslav Rezanina) [794806]
- [net] tg3: Apply short DMA frag workaround to 5906 (John Feeney) [796825]
- [net] tg3: Avoid panic from reserved statblk field access (John Feeney) [796825]
- [net] tg3: Fix 5717 serdes powerdown problem (John Feeney) [796825]
- [net] tg3: Fix RSS ring refill race condition (John Feeney) [796825]
- [net] tg3: Recode PCI MRRS adjustment as a PCI quirk (John Feeney) [796825]
- [net] tg3: Fix poor tx performance on 57766 after MTU change (John Feeney) [796825]
- [net] tg3: Fix jumbo loopback test on 5719 (John Feeney) [796825]
- [net] tg3: unify return value of .ndo_set_mac_address (John Feeney) [796825]
- [net] tg3: Clear RECOVERY_PENDING with reset_task_cancel (John Feeney) [796825]
- [net] tg3: remove IRQF_SAMPLE_RANDOM flag (John Feeney) [796825]
- [net] tg3: Update copyright (John Feeney) [796825]
- [net] tg3: Remove unused link config code (John Feeney) [796825]
- [net] tg3: Consolidate ASIC rev detection code (John Feeney) [796825]
- [net] tg3: Reduce UMP event collision window (John Feeney) [796825]
- [net] tg3: Fix NVRAM page writes on newer devices (John Feeney) [796825]
- [net] tg3: Fix copper autoneg adv checks (John Feeney) [796825]
- [net] tg3: Fix stats while interface is down (John Feeney) [796825]
- [net] tg3: Disable new DMA engine for 57766 (John Feeney) [796825]
- [net] tg3: Move transmit comment to a better location (John Feeney) [796825]
- [net] tg3: Relocate tg3_find_peer (John Feeney) [796825]
- [net] tg3: Move tg3_nvram_write_block functions (John Feeney) [796825]
- [net] tg3: Move tg3_set_rx_mode (John Feeney) [796825]
- [net] tg3: Move tg3_change_mtu to a better location (John Feeney) [796825]
- [net] tg3: Relocate tg3_reset_task (John Feeney) [796825]
- [net] tg3: Move tg3_restart_hw to a better location (John Feeney) [796825]
- [net] tg3: Remove alloc_etherdev error messages (John Feeney) [796825]
- [net] tg3: fix ipv6 header length computation (John Feeney) [796825]
- [net] net: fix assignment of 0/1 to bool variables. (John Feeney) [796825]
- [net] tg3: Break out RSS indir table init and assignment (John Feeney) [796825]
- [net] tg3: Use mii_advertise_flowctrl (John Feeney) [796825]
- [net] tg3: Add 57766 ASIC rev support (John Feeney) [796825]
- [net] tg3: Make the TX BD DMA limit configurable (John Feeney) [796825]
- [net] tg3: Enable EEE support for capable 10/100 devs (John Feeney) [796825]
- [net] tg3: Update version to 3.122 (John Feeney) [796825]
- [net] tg3: Return flowctrl config through ethtool (John Feeney) [796825]
- [net] tg3: Integrate flowctrl check into AN adv check (John Feeney) [796825]
- [net] tg3: Save stats across chip resets (John Feeney) [796825]
- [net] tg3: Remove ethtool stats member from dev struct (John Feeney) [796825]
- [net] tg3: Restrict large prod ring cap devices (John Feeney) [796825]
- [net] tg3: Adjust BD replenish thresholds (John Feeney) [796825]
- [net] tg3: Make 1000Base-X FC resolution look like 1000T (John Feeney) [796825]
- [net] tg3: Fix advertisement handling (John Feeney) [796825]
- [net] tg3: Change mii to ethtool advertisement function names (John Feeney) [796825]
- [net] tg3: Add ethtool to mii advertisment conversion helpers (John Feeney) [796825]
- [net] tg3: convert some .get_drvinfo routines to strlcpy (John Feeney) [796825]
- [net] tg3: Update version to 3.121 (John Feeney) [796825]
- [net] tg3: Eliminate timek 8X
)-@)-(-*-Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDAڭ	DaAڭ
ADCDCAADR8BѕQAޕ*DCDCDCDCADCDCDCDCDCDCDCTn=C#C#Ae>Bȭ@GL@?@@cl@c@gC@$@GL??o@GLOA吐?oAwAz?&??ЈBAA	?oA^?o@s?B0I@dB0[@fADCDDADADDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDAADCDCDCDCADDCDCDCAAAADCDCDA,@/Q@/QA,@/Q@/Q@/Q@/QA,A,A,A,A,A,A,A,A,D=&D=qoG=qoG=qoG=qoG=qoG=qoG=qoG=qoG=qoG=qoG=&=&=&=&=&=&=&=&=&=&=&=&=&=s>bR=&=M=MA,A,A,A,DCADADCDCBIDCCWeTn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=Tn=0fa2e269d59359effc00ec961f3dc3efb6c782181514e6041832177e737e970b46614a46cb5e6731461260983776ed41e635cbd8ce1a315aafbc375729d11e68e12fcd63e7794f33e8d8413d0d8af7d9af1837e10439a9b51594d24fb9e7467cb94ad396432198d7afa6510785f2d375f7f1de4d13c363efce39667e2964cd544e1ca6554b98687e75d03662cd92d14ef68037df4116eca43de5d5ab8ad0334acb9296fc2152a228877090cdc83e1674fa8ccdac0c988527c10a70526431d50de4200d5c640e81b25a9d555b9f6cc71de05584b18baf26c8c22f412e3b37e18826383e1054e30d81cf63124e8178d3799dc0d6059a65cfb465d17fd033bc90973b1e07dcf7f3216fd363027cb3678b2cdaca1a0b46b8f397d4c947b60af2e2d6458744994ce45953912bfd7f9ce649819ad1eb96b811588ed6b38996ca9debdedb123ed3ecc27ab31b3f808e96edb492baceaa38344804991daaa6ac02eba117b4f2066ea93d1954204c470d5400b7a77cc2285f51fe462adc755a62eaae0e00964544fa6393046d33be0a0036c0cd9f18d218e6ed222cf5838f707973e6b1f5850655b54054f242945214f30c7f4a294c0276f70815e3412aa5fde3122a7d916d9b64d81f5fdf184290b568d55de82935bbb14cd1f44c56f51d19940a1b77b971b2594d6fec6e050724f65fa9db8485c7b55c94918e79e5ded769790677709aed40d1f0990d2c1933ce6b76b3654962112b86cc9835e23875befff7cb15968e13b5a9a27eb446e3718cc7f685458750ee56b03672d9a5d68ea54bd2a7530403ee0895ec92bb9d2ef5d96c96de3b836b3c248d52f275e24614cf6495c0d82bb9e3a4864f47bcd8c8c8709ea34d4c27c1dad0bd4ce785fcf42103d2c47fac765e250d74650e30465b6cb6f7d6d09e1fc1371cab6eb54b09cb08ac4861f7eaef3eb9f0b8acddfee9b620ea822978a51d291592f31471eeb1901f5936e8c00fcdc68b263e123ad2b0ed3903aee19fc9feba9e53f8e94f5e35fb9f10c4f8b1ab5f59b81a01ffac862e972b1ae371297e770b7784ffc4f10dfe649aeea3592f7405aabdba89d100bdc7432f6d19c18acda7f1bb534b261fef13bde1378462c49af9d7f5fc9e608cdd2ccfd28ec73cedb8f152a07f9db1c83755505dbf961c953efdf82635ee4732be3c4d2e002ead8e194feb48f721030411d70ea9bacb2e47ff7e9df077135fb557311f2f2c1af4a9e73ca9d2cb021d7598f80c871232a8485d6af28294cc51b02fef23d53585962d4ff6d8652da15d7537edae9913f52c42f53e2526b48091fe5bde4ca6f5d5e87aa826a5decc2e28a105d4368a57b19954e6c342133879ede0cc34f40a5207319ac962795eaf888cd00a88255a1b5da5441361d9c250c0dc7ea25b6a6019aadadf99e01098ee92fcae061a623fdb4412910bf4f4FkX@ GLX. (#498357)- xserver-1.1.1-fix-prgn-leak.patch: Fix a region leak in composite wrapper (#854634)- xserver-1.1.1-getimage-sanity.patch: Fix a crash in GetImage (#508923)- xserver-1.1.1-regen-leaks.patch: Fix various memory leaks on server
  regeneration. (#498357)- xserver-1.1.1-randr-select-input-endian.patch: Fix byteswapping of
  RRSelectInput. (#794810)- cve-2011-4028.patch: File existence disclosure vulnerability.- cve-2011-4818.patch: Multiple input sanitization flaws in Render and GLX
- xorg-x11-server-1.1.0-mesa-copy-sub-buffer.patch: Likewise.- xserver-1.1.1-fbdev-iterate-modes.patch: fix fbdev driver not iterating
  across all modes of a certain dimension (#740497)- xserver-1.1.1-midc-double-free.patch: Don't double-free the picture for
  the root window when using the mi (software) cursor path. (#674741)- xserver-1.1.1-bigreqs-buffer-size.patch: Fix BIG-REQUESTS buffer size
  (#555000)- xserver-1.1.1-xinerama-crash.patch: Fix a crash in XineramaQueryScreens
  when client is swapped (#588346)- xserver-1.1.1-xephyr-keymap.patch: Fix types in Xephyr keymap setup (#454409)- xserver-1.1.1-wideline-overflow.patch: Fix integer overflow in wide line
  renderer (#649810)- Fix mouse stuck on edge (#529717)- xserver-1.1.1-bs-crash.patch: Fix a crash in backing store. (#676270)- xserver-1.1.1-randr-fix-mouse-crossing.patch: fix zaphod mouse crossing (#559964)- cve-2010-1166.patch: Fix broken modulo math in Render and arc code.
  Identical to xserver-1.1.1-mod-macro-parens.patch in 5.5.z. (#582651)- xserver-1.1.1-dbe-validate-gc.patch: Validate the GC against both front
  and back buffers (#596899)- xserver-1.1.1-no-randr-while-off-vt.patch: Also for RANDR 1.2 (#496108)- xserver-1.1.1-pam.patch: Enable PAM support. (#486120)- randr-disabled-fb.patch: Drop. (#496108)
- xserver-1.1.1-no-randr-while-off-vt.patch: Just refuse RANDR changes while
  VT switched away, rather than try to fake them (#496108)- add the qxl driver to the autodetection code (#558611)- fix randr upsizing not resizing pixmap (#515609)
- fix bug in overlapping bugfix (#530309,#516204,#554571)- xserver-1.1.1-improve-mode-selection.patch: Improve mode selection when
  validation filters away all modes that exactly match aspect ratio (#507536)- Update mesa-source buildreq (#435963)- fix overlapping xinerama information breaks gnome-screensaver (#530309,#516204)- Rebuild against new proto-devel (#439797)- Obsoletes: xorg-x11-server-randr-source (#504698)- xserver-1.1.1-hw-xfree86-modes.patch: Fix miscompilation of Xinerama
  protocol. (#503770)- Pull in fixes for x86emu from upstream as x86emu-update.patch.  This
  adds support for RDTSC, CPUID and fixes BSF and BSR and a 64 bit
  bug.  Drop xserver-1.1.1-int10-bsf.patch (#503182).- xserver-1.1.1-randr-abi.patch: Fix a crash on LP64 machines.- xserver-1.1.1-putimage-lp64-fix.patch: Fix an integer promotion bug
  in PutImage (#467370)- xserver-1.1.1-randr-panning-fix.patch: Install a null PointerMoved hook
  so we don't pan the second head on randrful drivers. (#477177)- xserver-1.1.1-option-max-clients.patch: Add -maxclients command line
  switch. (#439797)- xserver-1.1.1-hw-xfree86-modes-16.patch: Update RANDR code to 1.6ish.
- xserver-1.1.1-randr-abi.patch: Export the RANDR symbols that the drivers
  use, and compensate for i2c/ddc/ramdac still being loadables in 1.1.- xserver-1.1.1-ddc-update.patch: Update DDC code to xserver 1.6.
- xserver-1.1.1-hw-xfree86-modes: Add RANDR setup code, equivalent to the
  old randr-source subpackage (Fedora's 1.5.3 ish)
- drop the randr-* patches, merged into the above.- Drop the -randr-source subpackage
- Delete with_developer_utils macro and some boring/misleading comments- rediff the update patch- randr-xinerama.patch - add xinerama support to the randr source code
  tree (#481067)
- drop the randr source updates for now as the patch fails
- fix spec file so if patches to randr source fail, build fails- xserver-1.1.1-autoreconf-pedantry.patch: Fix autoreconf with new autotools
- xserver-1.1.1-saturate-tl.@...er <twoerner@redhat.com> 8.13.0-1.1Thomas Woerner <twoerner@redhat.com> 8.13.0-1Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 8.12.11-4.6Dan Walsh <dwalsh@redhat.com> 8.12.11-4.5Thomas Woerner <twoerner@redhat.com> 8.12.11-4.4Thomas Woerner <twoerner@redhat.com> 8.12.11-4.3Thomas Woerner <twoerner@redhat.com> 8.12.11-4.2Thomas Woerner <twoerner@redhat.com> 8.12.11-4.1Thomas Woerner <twoerner@redhat.com> 8.12.11-4Elliot Lee <sopwith@redhat.com>Thomas Woerner <twoerner@redhat.com> 8.12.11-3.2Thomas Woerner <twoerner@redhat.com> 8.12.11-3Thomas Woerner <twoerner@redhat.com> 8.12.11-2.1Thomas Woerner <twoerner@redhat.com> 8.12.11-2Thomas Woerner <twoerner@redhat.com> 8.12.11-1.3Thomas Woerner <twoerner@redhat.com> 8.12.11-1.2Thomas Woerner <twoerner@redhat.com> 8.12.11-1.1Thomas Woerner <twoerner@redhat.com> 8.12.11-1Thomas Woerner <twoerner@redhat.com> 8.12.10-7Thomas Woerner <twoerner@redhat.com> 8.12.10-6Florian La Roche <Florian.LaRoche@redhat.de>Jeff Johnson <jbj@jbj.org> 8.12.10-5Florian La Roche <Florian.LaRoche@redhat.de>Karsten Hopp <karsten@redhat.de> 8.12.10-3Karsten Hopp <karsten@redhat.de> Florian La Roche <Florian.LaRoche@redhat.de>Harald Hoyer <harald@redhat.de> 8.12.10-2Jeff Johnson <jbj@jbj.org> 8.12.10-1.2Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com> 8.12.9-6Nalin Dahyabhai <nalin@redhat.com> 8.12.9-5Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Phil Knirsch <pknirsch@redhat.com> 8.12.5-7.2Than Ngo <than@redhat.com> 8.12.5-7.1Florian La Roche <Florian.LaRoche@redhat.de>Phil Knirsch <pknirsch@redhat.com>Phil Knirsch <pknirsch@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 8.12.2-5Bill Nottingham <notting@redhat.com> 8.12.2-3Nalin Dahyabhai <nalin@redhat.com> 8.12.2-2Nalin Dahyabhai <nalin@redhat.com> 8.12.2-1Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 8.11.6-12Bill Nottingham <notting@redhat.com> 8.11.6-11Bernhard Rosenkraenzer <bero@redhat.com> 8.11.6-10Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La dkЫ2u@ut/Q///////////	/
/A//B/C///
/////D//)//"/R/S/T////#/X/Y/////////////////////E/2///////*///3/////////////////// //$/%/~/!//"/#/+///$/%///&//'/,/(/)///*/+//,/-///.///0/1//2//3/F//4///&///5/6/'/7/ /8//9/:/;//-/.////<///=//>/?//0/@//(/A///B//C/D////E///F/G////H//4/I//J/)/!/K/+//5/L////////M//N//O/P/Q/G/R//S/T/U///V///6//W/X/7/H/Y//-//1/2/3//Z/"/4/[//\//]/^///_/`//I//a////b/c//0//d//////e//f/g/h/i/j///#/J/k/8/K//l//m/n/o/p/q//r/s/L////M//9/t//u//v//w/x//N/y/z/{/O/$/|/}/5/~/://////////%///////	/
//////
///////////&/P//6////////;/////////////////////////////////////////////////////d/7/8/
/9/g/h///
//:/;/</=/>/?/@/i/j/A/B/C/D/E/k/F/G/l/H/I/o//J/////////////////q/K/L/u/M/v/N/O///////////////////w/P/Q/R/S/x/}/~/T///////////////////////////////	///////_4.2.6-10.el5_114.2.6-10.el5_11											





CkpPT@ Airlie <airlied@redhat.com> 1.1.1-48.94Adam Jackson <ajax@redhat.com> 1.1.1-48.93Adam Jackson <ajax@redhat.com> 1.1.1-48.92Adam Jackson <ajax@redhat.com> 1.1.1-48.91Adam Jackson <ajax@redhat.com> 1.1.1-48.90Adam Jackson <ajax@redhat.com> 1.1.1-48.88Dave Airlie <airlied@redhat.com> 1.1.1-48.87Adam Jackson <ajax@redhat.com> 1.1.1-48.86Adam Jackson <ajax@redhat.com> 1.1.1-48.85Adam Jackson <ajax@redhat.com> 1.1.1-48.84Adam Jackson <ajax@redhat.com> 1.1.1-48.83Adam Jackson <ajax@redhat.com> 1.1.1-48.82Dave Airlie <airlied@redhat.com> 1.1.1-48.81Adam Jackson <ajax@redhat.com> 1.1.1-48.80Dave Airlie <airlied@redhat.com> 1.1.1-48.79Adam Jackson <ajax@redhat.com> 1.1.1-48.78Adam Jackson <ajax@redhat.com> 1.1.1-48.77Adam Jackson <ajax@redhat.com> 1.1.1-48.76Adam Jackson <ajax@redhat.com> 1.1.1-48.75Adam Jackson <ajax@redhat.com> 1.1.1-48.73Soren Sandmann <ssp@redhat.com> 1.1.1-48.72Dave Airlie <airlied@redhat.com> 1.1.1-48.71Adam Jackson <ajax@redhat.com> 1.1.1-48.70Adam Jackson <ajax@redhat.com> 1.1.1-48.69Dave Airlie <airlied@redhat.com> 1.1.1-48.68Adam Jackson <ajax@redhat.com> 1.1.1-48.67Adam Jackson <ajax@redhat.com> 1.1.1-48.65Adam Jackson <ajax@redhat.com> 1.1.1-48.64Kristian Høgsberg <krh@redhat.com> - 1.1.1-48.63Adam Jackson <ajax@redhat.com> 1.1.1-48.62Adam Jackson <ajax@redhat.com> 1.1.1-48.61Adam Jackson <ajax@redhat.com> 1.1.1-48.60Adam Jackson <ajax@redhat.com> 1.1.1-48.59Adam Jackson <ajax@redhat.com> 1.1.1-48.58Adam Jackson <ajax@redhat.com> 1.1.1-48.57Adam Jackson <ajax@redhat.com> 1.1.1-48.56Adam Jackson <ajax@redhat.com> 1.1.1-48.55Dave Airlie <airlied@redhat.com> 1.1.1-48.54Adam Jackson <ajax@redhat.com> 1.1.1-48.53Dave Airlie <airlied@redhat.com> 1.1.1-48.52Dave Airlie <airlied@redhat.com> 1.1.1-48.51Adam Jackson <ajax@redhat.com> 1.1.1-48.50Dave Airlie <airlied@redhat.com> 1.1.1-48.49Dave Airlie <airlied@redhat.com> 1.1.1-48.48Adam Jackson <ajax@redhat.com> 1.1.1-48.47Dave Airlie <airlied@redhat.com> 1.1.1-48.46Dave Airlie <airlied@redhat.com> 1.1.1-48.45Adam Jackson <ajax@redhat.com> 1.1.1-48.44Dave Airlie <airlied@redhat.com> 1.1.1-48.43Dave Airlie <airlied@redhat.com> 1.1.1-48.42Dave Airlie <airlied@redhat.com> 1.1.1-48.41Dave Airlie <airlied@redhat.com> 1.1.1-48.40Adam Jackson <ajax@redhat.com> 1.1.1-48.39Dave Airlie <airlied@redhat.com> - 1.1.1-48.38Dave Airlie <airlied@redhat.com> - 1.1.1-48.37Dave Airlie <airlied@redhat.com> - 1.1.1-48.36Dave Airlie <airlied@redhat.com> - 1.1.1-48.35Kristian Høgsberg <krh@redhat.com> - 1.1.1-48.34Adam Jackson <ajax@redhat.com> 1.1.1-48.33Adam Jackson <ajax@redhat.com> 1.1.1-48.32Adam Jackson <ajax@redhat.com> 1.1.1-48.31Adam Jackson <ajax@redhat.com> 1.1.1-48.30Adam Jackson <ajax@redhat.com> 1.1.1-48.29Adam Jackson <ajax@redhat.com> 1.1.1-48.28Dave Airlie <airlied@redhat.com> 1.1.1-48.27Adam Jackson <ajax@redhat.com> 1.1.1-48.26Adam Jackson <ajax@redhat.com> 1.1.1-48.25Adam Jackson <ajax@redhat.com> 1.1.1-48.24Adam Jackson <ajax@redhat.com> 1.1.1-48.23Adam Jackson <ajax@redhat.com> 1.1.1-48.22Adam Jackson <ajax@redhat.com> 1.1.1-48.21Adam Jackson <ajax@redhat.com> 1.1.1-48.20Adam Jackson <ajax@redhat.com> 1.1.1-48.19Adam Jackson <ajax@redhat.com> 1.1.1-48.18Adam Jackson <ajax@redhat.com> 1.1.1-48.17Adam Jackson <ajax@redhat.com> 1.1.1-48.15Adam Jackson <ajax@redhat.com> 1.1.1-48.14.el5Adam Jackson <ajax@redhat.com>Adam Jackson <ajax@redhat.com> 1.1.1-48.13.el5Adam Jackson <ajax@redhat.com> 1.1.1-48.12.el5Soren Sandmann <sandmann@redhat.com> 1.1.1-48.11.el5Adam Jackson <ajax@redhat.com> 1.1.1-48.10.el5Soren Sandmann <sandmann@redhat.com> 1.1.1-48.9.el5Soren Sandmann <sandmann@redhat.com> 1.1.1-48.8.el5Adam Jackson <ajax@redhat.com> 1.1.1-48.7.el5Soren Sandmann <sandmann@redhat.coM> 1.1.1-48.6.el5Adam Jackson <ajax@redhat.com> 1.1.1-48.5.el5Adam Jackson <ajax@redhat.com> 1.1.1-48.4.el5Soren Sandmann <sandmann@redhat.com> 1.1.1-48.3.el5Adam Jackson <ajackson@redhat.com> 1.1.1-48.2.el5Adam Jackson <ajackson@redhat.com> 1.1.1-48.1.el5Soren Sandmann <sandmlpp0@00031a2fc7f98d2719331c965f15f6208d5798715a7248092b26346213a5bf071f2109194087a1c709265871c63defc3a79b98ca0a8a68c1460d22761d1d18ec973b8efa923aebc3c0002a0a3b2ff8665fd88862ec8a2c6ec80a8fbb429ae8da47c33cd405c971e01234921f5fb51669cf2ec3965739ef3fa33191ea74461734707052447410679707f69999c80dcd25db97f5fb0902ef6c4a656089ff8556f57fa707cbddbf4bc4c0a9d7bcc0773482c6789a2557fca42ca7c85882622b811cae55c54ea1aff6989b4b26d77dcb551c4957ca65aabc9bef5c9c1f09560c3122099fb562e7fd49016f3985ebe94c0600ac851b4358445cf446738219181e53945eba359ffc02c481a653cf9b8e4307b94870ab9fafae518e4219b1fd8c3f63cfaca046f5a7cdd1c0b9960c0cacb7d9d0c2602a5577303200e3d0e6de727fcce55bca41d79ebb00152c5c3ff57b112de5bb05f2817b20eeced8b25b8c61d8c30446bbd5832abf58c4b1320f2d1dccf3d77fc6f8dc7d867593fad922c4a9efd989704a08622cb750804d0f2b519dbf3487229fe0cf14886c8d7892a540a1c728e5c250820b8317cfdea913978e295fc7b6cfbdab98d13e2a1e1f49cc62c20847768e0b76f85204270718c91948babcb4dcc0c3a42bfa7530055cf22b8f9ca892d885fd070c51bcfbc686b9801b1b11a8255da62c3d43db2f5b3f502ee7f4da262a2ca6193a2a38e32012ad70d015e2cb6f2d109d8f8001d1f00e1a353d1a01a7115c76a5b0f147efbef76adf6b6c89498cce64f4fabf233b7fd8b143cc7c23f3dcc082693e2a66cc3dd45682ff906a3cbb27e6b58960d34c8e2a91a3b20b668fc7b7e53733c13314253dc861c52391474067ddfa8e8e16e9570a5c628b4c0d433f54ab53efe47e80c0f84ddc5b0398f19b70089dfbc46268c730154e198def232d32829840afb3bc30c32b792c5d3bdaf9ceab553474158caca22e38648d8358b0575c1257539d9a67f3c0fa477894f8d82a8909736813cd8a3d14f3a00214d257620a7d7f665e856058b0a2e17b7298645f139f2a9bd6ee0bc32fa2cdce423f4d236ecf52f021956ef6c420c55f4d783966a79ca35e18d1605e18b631430e14ea96fbea5bb759def18902d03ea1e79fbdd388d39d1e9cf450f865283f4f66c8f1d4fe7040e4215337e3adb414237a0d445945750a8a5be1d824dc6142c3fdae85afdf2f9d70e45bcdb47d535a4b7a78d63a18c7facd9aa4c6f3262f16db829163fb5bf49694797633688bc7ad2d6acd35ad401944b8aea4cf4bbf3a3f568d665e9cc9f2d358d4415ae8a9f9b0f657f2fb6da5c945d5e4eb9b567670bce4aef613fbe8d10b5fd1b779127de44be42c108a6a162fa98dc260c8b686e592b1980fa5b9e446aab5bab80df1beb0ab372bac78ab9346af2b45140cc254e509a68e36f326c5e4013bb39385f84e47b3af85c3ee3179452d7a3e6ec1aaf7dd9732e8ecd8cade7614551cd93dcaedac4d8e6c10bcbe9e98c5d0fe82eab32c2f4062f9751394496a22c551858172af8709996d9acfa5144925337c21bc0cb06ab196dbb2226eda32116c233b1ef8310d99f27edc250211ed3fb693b1e1b6b996385caafea6478481fe02b1a2ec31c913e791c78427ed9a8b0a9a28244bb832593b8c6dfa1c5824c1e437a75e0c41606b1d8d114dabaf9c1467aeaeb10915d753184c33925abf57555ceca9a6f0eb05dda529cf4fda341797a1e307ee07713bdc6c3fc07196f53342e95befbb0f584494171392412fcbf35141eb4af645587add91414843b7c921c348618a4bc617acc4ae72a5ef323dde34b78eb63e49c94ba7f4c9463f5c128bc599bf850e13c3176ec8770b4792895dc2e4e05c336448a0a4bf760c0fb89b2ecda288a99e1c748688bb27aec56891849e8abd6d796d898c2bbb6ee2e3f8ac960b69dc38bd87b9ed6ff55250efde9c4216bfccf51e6523943e70522871bc8a21d6756772a568c2c7b3b8238ba581025b80c51b30f9e2bb04409d440d75b5b96045de0cbbd365b79778ce380a8285e8bb9893428042a16cd0f192b3604e3de8e04e38fa3af934c3a4ed1cd8d5760b9d94d44782a28b6a2d326edc090d37b783458225aae8c5912075af6746f4972824c814e3f8504e78622ebcfd76ffa20e07c6f551e1b86158ed189fa61d1e7c6fac750e01cfda6f318ed18a0868392f12c6786f5817cd619d427a9de6eb9ef3c198ae26b42b29c0edf9e9456887125de37321a7dc3fc3a1862c1bff33d3886cada2f188fdffa700fb03683c616545ce58f8a8404bf568fd4ed905c796dc1f33ddf7922f1601a09159d22690106e247967e0byelprootrootrootrootk@8@trootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrooj`@ ) [448978]
- [i386]: Add check for supported_cpus in powernow_k8 driver (Prarit Bhargava ) [443853]
- [i386]: Add check for dmi_data in powernow_k8 driver (Prarit Bhargava ) [443853]
- [sata] update sata_svw (John Feeney ) [441799]
- [net] fix recv return zero (Thomas Graf ) [435657]
- [misc] kernel crashes on futex (Anton Arapov ) [435178]- [misc] ttyS1 loses interrupt and stops transmitting (Simon McGrath ) [440121]- [x86] sanity checking for read_tsc on i386 (Brian Maly ) [443435]
- [xen] netfront: send fake arp when link gets carrier (Herbert Xu ) [441716]
- [net] fix xfrm reverse flow lookup for icmp6 (Neil Horman ) [446250]
- [net] negotiate all algorithms when id bit mask zero (Neil Horman ) [442820]
- [net] 32/64 bit compat MCAST_ sock options support (Neil Horman ) [444582]
- [misc] add CPU hotplug support for relay functions (Kei Tokunaga ) [441523]- [fs] race condition in dnotify (Alexander Viro ) [443440 439759] {CVE-2008-1669 CVE-2008-1375}- [scsi] cciss: allow kexec to work (Chip Coldwell ) [230717]
- [xen] ia64: set memory attribute in inline asm (Tetsu Yamamoto ) [426015]
- [xen] fix VT-x2 FlexPriority (Bill Burns ) [252236]- [x86_64] page faults from user mode are user faults (Dave Anderson ) [442101]
- [ia64] kdump: add save_vmcore_info to INIT path (Neil Horman ) [442368]
- [misc] infinite loop in highres timers (Michal Schmidt ) [440002]
- [net] add aes-ctr algorithm to xfrm_nalgo (Neil Horman ) [441425]
- [x86_64] 32-bit address space randomization (Peter Zijlstra ) [213483]
- Revert: [scsi] qla2xxx: pci ee error handling support (Marcus Barrow ) [441779]
- [pci] revert 'PCI: remove transparent bridge sizing' (Ed Pollard ) [252260]
- [ppc64] eHEA: fixes receive packet handling (Brad Peters ) [441364]- [xen] memory corruption due to VNIF increase (Tetsu Yamamoto ) [441390]
- [crytpo] use scatterwalk_sg_next for xcbc (Thomas Graf ) [439874]
- [video] PWC driver DoS (Pete Zaitcev ) [308531]
- [s390] cio: fix vary off of paths (Hans-Joachim Picht ) [436106]
- [pci] fix MSI interrupts on HT1000 based machines (Doug Ledford ) [438776]
- [s390] cio: CHPID configuration event is ignored (Hans-Joachim Picht ) [431858]
- [x86_64] add phys_base to vmcoreinfo (Muuhh IKEDA ) [439304]
- [wd] disable hpwdt due to nmi problems (Prarit Bhargava ) [438741]
- [nfs] fix the fsid revalidation in nfs_update_inode (Steve Dickson ) [431166]
- [ppc64] SLB shadow buffer error cause random reboots (Brad Peters ) [440085]
- [xen] check num of segments in block backend driver (Bill Burns ) [378291]
- [sata] SB600: add 255-sector limit (Bhavana Nagendra ) [434741]
- [x86_64] fix unprivileged crash on %cs corruption (Jarod Wilson ) [439788]
- [scsi] qla4xxx: update driver version number (Marcus Barrow ) [439316]
- [acpi] only ibm_acpi.c should report bay events (Prarit Bhargava ) [439380]
- [x86] xen: fix SWIOTLB overflows (Stephen C. Tweedie ) [433554]
- [x86] fix mprotect on PROT_NONE regions (Stephen C. Tweedie ) [437412]
- [net] ESP: ensure IV is in linear part of the skb (Thomas Graf ) [427248]
- [x86] fix 4 bit apicid assumption (Geoff Gustafson ) [437820]
- [sata] SB700/SB800 64bit DMA support (Bhavana Nagendra ) [434741]- [pci] hotplug: PCI Express problems with bad DLLPs (Kei Tokunaga ) [433355]
- [net] bnx2x: update 5.2 to support latest firmware (Andy Gospodarek ) [435261]
- [ipsec] use hmac instead of digest_null (Herbert Xu ) [436267]
- [utrace] race crash fixes (Roland McGrath ) [428693 245429 245735 312961]
- [x86_64] EXPORT smp_call_function_single (George Beshers ) [438720]
- [s390] FCP/SCSI write IO stagnates (Jan Glauber ) [437099]
- [net] ipv6: check ptr in ip6_flush_pending_frames (Neil Horman ) [439059]
- [nfs] stop sillyrenames and unmounts from racing (Steve Dickson ) [437302]
- [ppc64] oprofile: add support for Power5+ and later (Brad Peters ) [244719]
- [agp] add cantiga ids (Geoff Gustafson ) [438919]
- [x86] oprofile: support for Penryn-class processors (Geoff Gustafson ) [253056]
- [net] ipv6: fix default address selection rule 3 (Neil Horman ) [438429]
- [audit] fix pjpi`,
	@	
requency transitions (Bhavana Nagendra ) [245082]
- [CIFS] respect umask when unix extensions are enabled (Jeff Layton ) [246667]
- [CIFS] fix signing sec= mount options (Jeff Layton ) [246595]
- [XEN] netloop: Do not clobber cloned skb page frags (Herbert Xu ) [249683]- [net] Using mac80211 in ad-hoc mode can result in a kernel panic (John W. Linville ) [223558]
- [ppc] Axon memory does not handle double bit errors (Scott Moser ) [249910]
- [xen] x86: HV workaround for invalid PAE PTE clears (Chris Lalancette ) [234375]
- [scsi] Update stex driver (Jeff Garzik ) [241074]
- [scsi] cciss: Re-add missing kmalloc (Prarit Bhargava ) [249104]
- [GFS2] Fix an oops in the glock dumping code (Steven Whitehouse ) [248479]
- [GFS2] locksmith/revolver deadlocks (Steven Whitehouse ) [249406]
- [xen] race loading xenblk.ko and scanning for LVM partitions (Richard Jones ) [247265]- [NFS] Re-enable force umount (Steve Dickson ) [244949]
- [sata] regression in support for third party modules (Jeff Garzik ) [248382]
- [utrace] set zombie leader to EXIT_DEAD before release_task (Roland McGrath ) [248621]- [XEN] fix time going backwards in gettimeofday (Rik van Riel ) [245761]
- [GFS2] soft lockup in rgblk_search (Bob Peterson ) [246114]
- [DLM] fix NULL reference in send_ls_not_ready (David Teigland ) [248187]
- [DLM] Clear othercon pointers when a connection is closed (David Teigland ) [220538]- [wireless] iwlwifi: add driver (John W. Linville ) [223560]
- [XEN] make crashkernel=foo@16m work (Gerd Hoffmann ) [243880]
- [XEN] ia64: HV built with crash_debug=y does not boot on NUMA machine (Kei Tokunaga ) [247843]
- [edac] allow edac to panic with memory corruption on non-kdump kernels (Don Zickus ) [237950]
- [GFS2] Mounted file system won't suspend (Steven Whitehouse ) [192082]
- [GFS2] soft lockup detected in databuf_lo_before_commit (Bob Peterson ) [245832]
- [sata] Add Hitachi HDS7250SASUN500G 0621KTAWSD to NCQ blacklist (Prarit Bhargava ) [247627]
- [PCI] unable to reserve mem region on module reload (Scott Moser ) [247701 247400]
- [PPC] eHEA driver can cause kernel panic on recv of VLAN packets (Scott Moser ) [243009]
- [PPC] Fix 64K pages with kexec on native hash table (Scott Moser ) [242550]
- Reverts: Mambo driver on ppc64 [208320]- [XEN] ia64: Windows guest cannot boot with debug mode (Kei Tokunaga ) [245668]
- [XEN] ia64: SMP Windows guest boot fails sometimes (Kei Tokunaga ) [243870]
- [XEN] ia64: Dom0 boot fails on NUMA hardware (Kei Tokunaga ) [245275]
- [XEN] ia64: Windows guest sometimes panic by incorrect ld4.s emulation (Kei Tokunaga ) [243865]
- [XEN] ia64: boot 46 GuestOS makes Dom0 hang (Kei Tokunaga ) [245667]
- [XEN] ia64: HVM guest hangs on vcpu migration (Kei Tokunaga ) [233971]
- [XEN] ia64: Cannot create guest domain due to rid problem (Kei Tokunaga ) [242040]
- [XEN] ia64: HVM domain creation panics if xenheap is not enough. (Kei Tokunaga ) [240108]
- [XEN] ia64: DomU panics by save/restore (Kei Tokunaga ) [243866]
- [XEN] ia64: Guest OS hangs on IPF montetito (Kei Tokunaga ) [245637]
- [xen] Guest access to MSR may cause system crash/data corruption (Bhavana Nagendra ) [245186]
- [xen] Windows HVM guest image migration causes blue screen (Bhavana Nagendra ) [245169]
- [xen] ia64: enable blktap driver (Jarod Wilson ) [216293]
- [scsi] check portstates before invoking target scan (David Milburn ) [246023]
- [nfs] NFSd oops when exporting krb5p mount (Steve Dickson ) [247120]
- [misc] Overflow in CAPI subsystem (Anton Arapov ) [231072] {CVE-2007-1217}
- [dlm] A TCP connection to DLM port blocks DLM operations (Patrick Caulfield ) [245892] {CVE-2007-3380}
- [dm] allow invalid snapshots to be activated (Milan Broz ) [244215]
- [gfs2] inode size inconsistency (Wendy Cheng ) [243136]
- [gfs2] Remove i_mode passing from NFS File Handle (Wendy Cheng ) [243136]
- [gfs2] Obtaining no_formal_ino from directory entry (Wendy Cheng ) [243136]
- [gfs2] EIO error from gfs2_block_truncate_page (Wendy Cheng ) [243136]
- [gfs2] remounting w/o acl option leaves acls enabled (Bob Peterson ) [245663]kPI@otrootrootrootpcre-6.6-9.el5.src.rpmpcre-devel@@@@JJ/bin/shlibpcre.so.0libpcrecpp.so.0libpcreposix.so.0pcrerpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)6.6-9.el53.0.4-14.0-14.4.2.3QmQhMlLGmGPG:`G:`G4`GDpDaCC`C`CB(`B
*A`A`@q`@``@R2@E@-H?t>k>>/`>-=ި=I=`==H==<f`<`<?``;`;I:`Petr Pisar <ppisar@redhat.com> - 6.6-9Petr Pisar <ppisar@redhat.com> - 6.6-8Petr Pisar <ppisar@redhat.com> - 6.6-7Petr Pisar <ppisar@redhat.com> - 6.6-6Stepan Kasal <skasal@redhat.com> - 6.6-5Stepan Kasal <skasal@redhat.com> - 6.6-4Stepan Kasal <skasal@redhat.com> - 6.6-3Josh Bressers <bressers@redhat.com> 6.6-2.4Than Ngo <than@redhat.com> 6.6-2.3Jesse Keating <jkeating@redhat.com> - 6.6-1.1Than Ngo <than@redhat.com> 6.6-1Jesse Keating <jkeating@redhat.com> - 6.3-1.2.1Jesse Keating <jkeating@redhat.com> - 6.3-1.2Jesse Keating <jkeating@redhat.com>Than Ngo <than@redhat.com> 6.3-1Joe Orton <jorton@redhat.com> 5.0-4Joe Orton <jorton@redhat.com> 5.0-3Joe Orton <jorton@redhat.com> 5.0-2Than Ngo <than@redhat.com> 5.0-1Elliot Lee <sopwith@redhat.com>Than Ngo <than@redhat.com> 4.5-2Than Ngo <than@redhat.com> 4.5-1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Harald Hoyer <harald@redhat.de> 4.4-1Elliot Lee <sopwith@redhat.com>Than Ngo <than@redhat.com> 4.2-1Tim Powers <timp@redhat.com>Than Ngo <than@redhat.com> 3.9-9Elliot Lee <sopwith@redhat.com> 3.9-8Than Ngo <than@redhat.com> 3.9-7Than Ngo <than@redhat.com> 3.9-7Than Ngo <than@redhat.com> 3.9-6Than Ngo <than@redhat.com> 3.9-5.1Bernhard Rosenkraenzer <bero@redhat.com> 3.9-5Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 3.9-2Bernhard Rosenkraenzer <bero@redhat.com> 3.9-1Bernhard Rosenkraenzer <bero@redhat.com> 3.7-1Bernhard Rosenkraenzer <bero@redhat.com> 3.4-2Bernhard Rosenkraenzer <bero@redhat.com>- Fix back-tracking Unicode properties in non-UTF-8 mode (Resolves: #866520)- Fix pcregrep -Mv looping bug (Resolves: #859959)- Do not loop while compiling extended class when not in UTF-8 mode
  (Resolves: #669413)- Enable Unicode properties (Resolves: #457064)- Fix the names of the pacthes added in pcre-6.6-3:
  mv pcre-6.4-posix.diff pcre-6.6-CVE-2006-7225.patch
  mv pcre-6.4-fix1.patch pcre-6.6-CVE-2006-7226.patch
- Update pcre-6.6-CVE-2007-1659.patch
- Update pcre-6.6-CVE-2007-1660.patch
- Add pcre-6.6-CVE-2006-7230.patch
- Resolves: #380541- Use defined constants in pcre-6.6-CVE-2006-7224.patch
- Related: #373451- Improve the fix for CVE-2006-7224 by updating
  pcre-6.6-CVE-2006-7224.patch and adding pcre-6.4-fix1.patch
  and pcre-6.4-posix.diff
- Related: #373451- Resolves: #373451, CVE-2006-7224- Resolves: #315961, CVE-2007-1659, CVE-2007-1660- rebuild- update to 6.6
- fix multilib problem- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- update to 6.3- rebuild- don't print $libdir in 'pcre-config --libs' output- include LICENCE, AUTHORS in docdir
- run make check
- move %configure to %build- update to 5.0
- change License: BSD
- fix header location #64248- rebuilt- add the correct pcre license, #118781- update to 4.5- rebuilt- rebuilt- 4.4- rebuilt- update to 4.2- rebuilt- build with utf8, bug #81504- Really remove .la files- remove .la- Typo bug- Added missing so symlink- Fixed to build s390/s390x/x86_64- Fix #65009- automated rebuild- automated rebuild- rebuild- Update to 3.9- Update to 3.7- Move libpcre to /lib, grep uses it these days (#41104)- Move this to a separate package, used to be in kdesupport, but it's
  generally useful...builder17.centos.org 1380651445k`	,@,,,ASCII English textASCII textELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippeddirectorysymbolic link to `libuser.so.1.1.6'"#0:DN]n



RRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRPRRRRRRR	R
RRR
RPRRRRRR
RRRPRRRRRR
RRRPRRRRRR
RRRPRRRRRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRR
RRR
RRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRRRRRRR
RRR
RRRRRRRRsystem_u:object_r:etc_tsystem_u:object_r:bin_tsystem_u:object_r:bin_tsystem_u:object_r:lib_tsystem_u:object_r:lib_tsystem_u:object_r:lib_tsystem_u:object_r:lib_tsystem_u:object_r:lib_tsystem_u:object_r:lib_tsystem_u:object_r:lib_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:sbin_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:usr_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem*lH0@00PGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/hy/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ku/LC_MESSAGES//usr/share/locale/lo/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/lv/LC_MESSAGES//usr/share/locale/mai/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/my/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/no/LC_MESSAGES//usr/share/locale/nso/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/ur/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/locale/zu/LC_MESSAGES//usr/share//usr/share/system-config-kdump//usr/share/system-config-kdump/pixmaps/-O2cpiogzip9noarchnoarch-redhat-linux-gnuASCII English textASCII textBourne shell script text executablePNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedXML document textbroken symbolic link to `consolehelper'directoryR? 9|`X`$ċMk?Qj(GV(e\g|X+yG5/[QE1ʮfqf?Qj(GV()~jU'!tPw8]ﲛ&F(4H]af6db1eafaace00fb2a54ab998afd83f69be6d9b\=O\<TQp Wq.Ym9 8BHJ_
b
U|nK9}F
~F
-d7Kڨ
b;}~ٞ+OH~k-@--RRR R'RRRRRRRRRRRRRRRRRR R'RRRRRRRRRRRRRRR R'?	6Thߺ҈?UxGV(c6{N!
[.yTPTey,W?UxGV(H~NRux)[p'LJdȨHae047a3acffd894cd7ccbc7d6a234daf6e95d9b6\=),(\<+(%))Q*$*]9>BGKN
XY	\]^_`af
qrtuvxyz{}:Z56
"<
(c:Z"%&*$5689"BF
HMSbfgkt#"mm"
# ,&.49&< J8LMa
hksx{|.
 .8EC_	"	
 H$$$$$(?-. 1458:;
<>?_CGNIWCX\]eq
tv
wx@n.

-8
EC	"<	?#$
(+
2586>@SIXZC[`d_gmikl_mmorun|||||||hostbyname.3p.gz5@dlclose.3p.gz5,ctanh.3p.gz5*ctan.3p.gz5close.3p.gz5ccosl.3p.gz5atanhf.3p.gz5tempnam.3.gz5strtol.3.gz5Rllroundf.3.gz5,j0l.3.gz5#iswlower.3.gz5ether_ntoa_r.3.gz5dremf.3.gz5|conjl.3.gz5Bset_tid_address.2.gz53sched_setscheduler.2.gz5
ptrace.2.gz5vfdatasync.2.gz5*ulimit.1p.gz5getconf.1p.gz5Jmonetary.h.0p.gz.legal.html.
.X.icxx.html...&txn_stat.html..db_class.html(N*Myacc.am(2)**1depend2.am&Jsavetty.3x.gz&mvwaddch.3x.gz&curs_printw.3x.gz&curs_extend.3x.gz&bkgd.3x.gz&attr_set.3x.gz&Flibpanel_g.a&Alibncursesw.a"		libgmp.a!.en_US-wo_accents-only.rws!#en_GB-ise.multi libboost_iostreams.so 

eat_whitespace.hpp input_iterator_facade.hpp xml_report_formatter.ipp eesymbols.ipp [[new.hpp rule.hpp hhintersection.ipp 		enum_trailing.hpp YYmul.hpp hashed_index.hppyku	@u	v	t	095)- rebuilt- require system-logos (#120837)- buildrequire automake (#125326)- i2o patch from Markus Lidel- read geometry off of the disk since HDIO_GETGEO doesn't actually 
  return correct data with a 2.6 kernel- add texinfo buildrequires (#118146)- don't use initrd_max_address- rebuilt- update to 0.94, patch merging and updating as necessary- new bootonce patch from Padraig Brady so that you don't lose 
  the old default (#112775)- add ncurses-devel as a buildrequires (#110732)- rebuild- Requires: /usr/bin/cmp (#98325)- add patch from upstream to fix build with gcc 3.3- add patch to fix support for serial terminfo (#85595)- rebuilt- add patch from HJ Lu to support large disks (#80980, #63848)
- add patch to make message when ending edit clearer (#53846)- add a patch to reset the terminal type to console before doing 'boot' from
  the command line (#61069)- update to 0.93
- update configfile patch
- graphics patch rework to fit in as a terminal type as present in 0.93
- use CFLAGS="-Os -g"
- patch configure.in to allow building if host_cpu=x86_64, include -m32 in
  CFLAGS if building on x86_64
- link glibc static on x86_64 to not require glibc32
- include multiboot info pages
- drop obsolete patches, reorder remaining patches into some semblance of order- splashscreen is in redhat-logos now- update splashscreen again- update splashscreen- automated rebuild- automated rebuild- add patch from Grant Edwards to make vga16 + serial happier (#63491)- update to 0.92
- back to autoreconf
- make it work with automake 1.6/autoconf 2.53
- use "-falign-jumps=1 -falign-loops=1 -falign-functions=1" instead of
  "-malign-jumps=1 -malign-loops=1 -malign-functions=1"	to not use 
  deprecated gcc options- new splash screen- include patch from Denis Kitzmen to fix typo causing several options to 
  never be defined (in upstream CVS)
- include patch from upstream CVS to make displaymem always use hex for 
  consistency
- add patch from GRUB mailing list from Keir Fraser to add a --once flag to
  savedefault function so that you can have the equivalent of lilo -R 
  functionality (use 'savedefault --default=N --once' from the grub shell)
- back to autoconf- change to use $grubdir instead of /boot/grub in the symlink patch (#58771)- don't ifdef out the auto memory passing, use the configure flag instead
- add a patch so that grub respects mem= from the kernel command line when 
  deciding where to place the initrd (#52558)- update to 0.91 final
- add documentation on splashimage param (#51609)- update to current CVS snapshot to fix some of the hangs on boot related
  to LBA probing (#57503, #55868, and others)- fixed append patch to not require arguments to begin with
- changed to autoreconf from autoconf- include additional patch from Erich to add sync calls in grub-install to 
  work around updated images not being synced to disk
- fix segfault in grub shell if 'password --md5' is used without specifying
  a password (#55008)- Include Erich Boleyn <erich@uruk.org>'s patch to disconnect from the 
  BIOS after APM operations.  Should fix #54375- added patch for 'a' option in grub boot menu- grub-install: if /boot/grub/grub.conf doesn't exist but /boot/grub/menu.lst 
  does, create a symlink- pull in patch from upstream CVS to fix md5crypt in grub shell (#52220)
- use mktemp in grub-install to avoid tmp races- link curses statically (#49519)- fix segfault with using the serial device before initialization (#50219)- add --copy-only flag to grub-install- copy files in grub-install prior to device probe- original images don't go in /boot and then grub-install does the right
  thing- fix the previous patch
- put the password prompt in the proper location- reset the screen when the countdown is cancelled so text will disappear 
  in vga16 mode- change configfile defaults to grub.conf- updated to grub 0.90 final- modifed splash screen to a nice shade of blue- added a first cut at a splash screen- fix datadir mismatch between build and install phases- update to current CVk7@ic libraries; NSS and dependencies no longer
  require static libraries to build.- Update to 4.6.1- rebuilt- Use the NSPR version numbering scheme reported by NSPR,
  which unfortunately is not exactly the same as the real
  version (4.6 != 4.6.0 according to RPM and pkgconfig).- Correct the CFLAGS reported by pkgconfig- Temporarily include the static libraries allowing nss and 
  its dependencies to build.- Update to NSPR 4.6- NSPR doesn't have make install, but it has make real_install.  Use it.- Let's make an RPM./sbin/ldconfig/sbin/ldconfigmozilla-nsprbuilder17.centos.org 1461584359//o/`4.11.0-1.el5_11libnspr4.solibplc4.solibplds4.so/usr/lib/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippeddirectoryPRRRRRRRR	R
RRR
RRRRRRRRPRRRRRPRRRRR?Y~1fH8n?W>GV(qf*-2ġ'l+Frz`9$q<h?W>GV(lBZ#`9 s!|κeq<p54_8f786d13bf4ae5d65b6ec344c7ec8ce6375bc61c\=h\<w.pyotest_codecmaps_cn.pytest_codecmaps_cn.pyctest_codecmaps_cn.pyotest_codecmaps_hk.pytest_codecmaps_hk.pyctest_codecmaps_hk.pyotest_codecmaps_jp.pytest_codecmaps_jp.pyctest_codecmaps_jp.pyotest_codecmaps_kr.pytest_codecmaps_kr.pyctest_codecmaps_kr.pyotest_codecmaps_tw.pytest_codecmaps_tw.pyctest_codecmaps_tw.pyotest_codecs.pytest_codecs.pyctest_codecs.pyotest_codeop.pytest_codeop.pyctest_codeop.pyotest_coercion.pytest_coercion.pyctest_coercion.pyotest_colorsys.pytest_colorsys.pyctest_colorsys.pyotest_commands.pytest_commands.pyctest_commands.pyotest_compare.pytest_compare.pyctest_compare.pyotest_compile.pytest_compile.pyctest_compile.pyotest_compiler.pytest_compiler.pyctest_compiler.pyotest_complex.pytest_complex.pyctest_complex.pyotest_contains.pytest_contains.pyctest_contains.pyotest_cookie.pytest_cookie.pyctest_cookie.pyotest_cookielib.pytest_cookielib.pyctest_cookielib.pyotest_copy.pytest_copy.pyctest_copy.pyotest_copy_reg.pytest_copy_reg.pyctest_copy_reg.pyotest_cpickle.pytest_cpickle.pyctest_cpickle.pyotest_crypt.pytest_crypt.pyctest_crypt.pyotest_csv.pytest_csv.pyctest_csv.pyotest_curses.pytest_curses.pyctest_curses.pyotest_datetime.pytest_datetime.pyctest_datetime.pyotest_dbm.pytest_dbm.pyctest_dbm.pyotest_decimal.pytest_decimal.pyctest_decimal.pyotest_decorators.pytest_decorators.pyctest_decorators.pyotest_deque.pytest_deque.pyctest_deque.pyotest_descr.pytest_descr.pyctest_descr.pyotest_descrtut.pytest_descrtut.pyctest_descrtut.pyotest_dict.pytest_dict.pyctest_dict.pyotest_difflib.pytest_difflib.pyctest_difflib.pyotest_difflib_expect.htmltest_dircache.pytest_dircache.pyctest_dircache.pyotest_dis.pytest_dis.pyctest_dis.pyotest_distutils.pytest_distutils.pyctest_distutils.pyotest_dl.pytest_dl.pyctest_dl.pyotest_doctest.pytest_doctest.pyctest_doctest.pyotest_doctest.txttest_doctest2.pytest_doctest2.pyctest_doctest2.pyotest_doctest2.txttest_dumbdbm.pytest_dumbdbm.pyctest_dumbdbm.pyotest_dummy_thread.pytest_dummy_thread.pyctest_dummy_thread.pyotest_dummy_threading.pytest_dummy_threading.pyctest_dummy_threading.pyotest_email.pytest_email.pyctest_email.pyotest_email_codecs.pytest_email_codecs.pyctest_email_codecs.pyotest_enumerate.pytest_enumerate.pyctest_enumerate.pyotest_eof.pytest_eof.pyctest_eof.pyotest_errno.pytest_errno.pyctest_errno.pyotest_exceptions.pytest_exceptions.pyctest_exceptions.pyotest_extcall.pytest_extcall.pyctest_extcall.pyotest_fcntl.pytest_fcntl.pyctest_fcntl.pyotest_file.pytest_file.pyctest_file.pyotest_fikP_=,@=,<,>,@redhat.com> - 0.90-3John (J5) Palmieri <johnp@redhat.com> - 0.90-2John (J5) Palmieri <johnp@redhat.com> - 0.90-1Jesse Keating <jkeating@redhat.com> - 0.62-1.1John (J5) Palmieri <johnp@redhat.com> - 0.62-1Matthias Clasen <mclasen@redhat.com> 0.61-6Karsten Hopp <karsten@redhat.de> 0.61-5.2 John (J5) Palmieri <johnp@redhat.com> - 0.61-5.1John (J5) Palmieri <johnp@redhat.com> - 0.61-5John (J5) Palmieri <johnp@redhat.com> 0.61-4John (J5) Palmieri <johnp@redhat.com> 0.61-3John (J5) Palmieri <johnp@redhat.com> 0.61-2John (J5) Palmieri <johnp@redhat.com> 0.61-1Jesse Keating <jkeating@redhat.com> - 0.60-7.2Jesse Keating <jkeating@redhat.com> - 0.60-7.1John (J5) Palmieri <johnp@redhat.com> 0.60-7John (J5) Palmieri <johnp@redhat.com> 0.60-6John (J5) Palmieri <johnp@redhat.com> 0.60-5Alexander Larsson <alexl@redhat.com> 0.60-4Alexander Larsson <alexl@redhat.com> 0.60-3Alexander Larsson <alexl@redhat.com> - 0.60-2Jesse Keating <jkeating@redhat.com> - 0.60-1.1John (J5) Palmieri <johnp@redhat.com> - 0.60-1John (J5) Palmieri <johnp@redhat.com> - 0.50-1John (J5) Palmieri <johnp@redhat.com> - 0.36.2-1John (J5) Palmieri <johnp@redhat.com> - 0.36.1-1John (J5) Palmieri <johnp@redhat.com> - 0.36-1John (J5) Palmieri <johnp@redhat.com> - 0.35.2-1John (J5) Palmieri <johnp@redhat.com> - 0.34-1John (J5) Palmieri <johnp@redhat.com> - 0.33-4Bill Nottingham <notting@redhat.com> - 0.33-3John (J5) Palmieri <johnp@redhat.com> - 0.33-2John (J5) Palmieri <johnp@redhat.com> - 0.33-1John (J5) Palmieri <johnp@redhat.com> - 0.32-6John (J5) Palmieri <johnp@redhat.com> - 0.32-5John (J5) Palmieri <johnp@redhat.com> - 0.32-4David Zeuthen <davidz@redhat.com> - 0.32-3John (J5) Palmieri <johnp@redhat.com> - 0.32-2John (J5) Palmieri <johnp@redhat.com> - 0.32-1John (J5) Palmieri <johnp@redhat.com> - 0.31-4John (J5) Palmieri <johnp@redhat.com> - 0.31-3John (J5) Palmieri <johnp@redhat.com> - 0.31-2John (J5) Palmieri <johnp@redhat.com> - 0.31-1John (J5) Palmieri <johnp@redhat.com> - 0.23-4John (J5) Palmieri <johnp@redhat.com> - 0.23-3John (J5) Palmieri <johnp@redhat.com> - 0.23-2John (J5) Palmieri <johnp@redhat.com> - 0.23-1Jeremy Katz <katzj@redhat.com> - 0.22-12John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>Tim Waugh <twaugh@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com> Colin Walters <walters@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>Elliot Lee <sopwith@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>John (J5) Palmieri <johnp@redhat.com>Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com> 0.20-4Elliot Lee <sopwith@redhat.com>Tim Waugh <twaugh@redhat.com>Havoc Pennington <hp@redhat.com> 0.20-2Bill Nottingham <notting@redhat.com> 0.20-1Havoc Pennington <hp@redhat.com> 0.13-6Havoc Pennington <hp@redhat.com> 0.13-5Havoc Pennington <hp@redhat.com> 0.13-4Havoc Pennington <hp@redhat.com> 0.13-3Havoc Pennington <hp@redhat.com> 0.13-2Havoc Pennington <hp@redhat.com> 0.13-1Havoc Pennington <hp@redhat.com> 0.11.91-3Elliot Lee <sopwith@redhat.com>Havoc Pennington <hp@redhat.com> 0.11.91-1Havoc Pennington <hp@redhat.com> 0.11.90-1Havoc Pennington <hp@redhat.com> 0.11-2Havoc Pennington <hp@redhat.com> 0.11-1Havoc Pennington <hp@redhat.com> 0.10.90-1Havoc Pennington <hp@redhat.com> 0.9-1Havoc Pennington <hp@redhat.com> 0.6.
j@4b182124b52bf39578519a81e1ffe4905d7f59164c79850b8cd94181b3c9b5959a7d55f436eb84f7d7aa0df1c94d3b88305826626e2c3e606a5af24a4c2e119b42a261e7c5fc499dce15fa73f1286dbd75f74a712aeb5fd08eb9587e6c08789c43bc9191c224dc2983f57a115683000aa6533175a60647079a6cf1095e2b06e38cee6469732457358739a4a71ba5742ee260d50d633d472d1fc22b9ca9d851462342321ffa026bb849b2d4024f23228e93fd90d3a60a76895cc2d14c8348cc13fa9c5e55dfee20575d205babf8dff40259f4e1cdadf0ed792affc71783615cbb306bb65146a03a007605eacb57abb8b030de19c054c1131ee2acbe297f9a18fb76bfc65b0915737c9f7edb9d5c800dcf10068275fe27cea0cd6e1120fc318c1e2f964649763d429883645b1c0f51c31b5d2acb79a4fe296df5d2dd34a1b544475eb5ba6aad3a0a5e150de49c1a58eb2a08d9821a89bce1e350ae0e464adc930ee23c6da6b529a2ff9812a0e3d4aba502a5ef9632251ae4e970a5a64a8d8ec80887ad40765dc9ceb72f11e0022896a61d4a5559a3a6afc088072813948beaa2853393df91c7a7edbddb092c93f73ba588d68141679821e9fe296a9a018feb8e25e6a31757c6b3070242418c8724bf926c23628c3f8d527b7d2fdc725fb8f7bde0a5c83de1432e4e5909deadfcd169488ebe96ec74bbba77cc94e3149cdd045decf6d2c2e7ccff9e7fdf2459ca021c4678a8d3a544549c5dfec9f3755a40fbc1de12d19996942a8d484758581327445a742daeb9568b622bbdddf904e3a962eb7f581dfc24b0997133f395550ada6b3050115fbec6280485f048b34de967bd2b99f37f88c7089d665c7b92dbd3507911f42147a4a1d8ff08de1b66ae22c9b4d56f6d41de4a8b14bd0dc72daea49a031337414100c0377a42fd1f1cb1691ef68b6dc297575c9ae8fda9df3f2c198dc76c237ad0e78a50cb41ae09a4d3bb99b674aae31a7c9606aa9c3ac6b6474c1be92247e1822441f46e8daeb64515147de45313b4dbba829bed53b230f5f90ac540eae1468f2725573116ff686a01eba5609b1d08a52afdcdd280807aedd394ecd071df3bd5df24d59abb934f0cfa07e53941de281688f526a743ad1libdevmapper-event-lvm2.so.2.02device-mapper/libdevmapper-event-lvm2mirror.sodevice-mapper/libdevmapper-event-lvm2snapshot.soliblvm2cmd.so.2.02lvm.staticlvm.staticlvm.staticlvm.staticlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvmlvm@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlvm2-2.02.88-13.el5.src.rpmMk0@@	ilds.
- Added dmx related utilities to Xdmx subpackage.
- Individually list each X server module in file manifest.
- Hack man1 manpages to be installed into man1x.
- Add the following ./configure options --disable-dependency-tracking,
  --enable-composite, --enable-xtrap, --enable-xcsecurity, --enable-xevie,
  --enable-lbx, --enable-dri, --with-mesa-source, --with-module-dir,
  --with-os-name, --with-os-vendor, --with-xkb-output, --disable-xorgcfg
- Added getconfig, scanpci et al to Xorg subpackage
- Added inb, inl, inw, ioport, outboutl, outw, pcitweak utils to Xorg package
  conditionally, defaulting to "off".  These utilities are potentially
  dangerous and can physically damage hardware and/or destroy data, so are
  not shipped by default.
- Added "BuildRequires: libdmx-devel" for dmx utilities
- Added "BuildRequires: libXres-devel" for Xres examples
- Added {_libdir}/xserver/SecurityPolicy to Xorg subpackage for XSECURITY- Fix license tag to be "MIT/X11"
- Change Xdmx subpackage to Obsolete xorg-x11-Xdmx instead of xorg-x11-Xnest- Update BuildRequires for new library package naming (libX...)
- Use Fedora Extras style BuildRoot tag
- Invoke make with _smp_mflags to take advantage of SMP systems- Go back to %spec -n, use new cvs snapshot that supports overriding
  moduledir during make install, use %makeinstall.
- Drop %{moduledir}/multimedia globs.- Added build dependency on xorg-x11-libfontenc-devel, as the build fails
  half way through without it, even though upstream dependencies do not
  specify it as required.- Initial spec file for the modular X server.XFree86-Xnestxorg-x11-Xnestbuilder17.centos.org 14183266247.66
1.1.1-48.107.el5.centosXnestXnest.1x.gzXserver.1x.gz/usr/bin//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippeddirectoryRRRRRRRRRR	R
RRR
RRRRR?02m`3;?TlGV(<c\'	8!EX#͑?TlGV([Kܿ	`EdNˀ{~d6zIt?>(,219fb783ed087d275a3f6f7c614508282a89d571\<9B\<(PR middle-end/28683)- update from gcc-4_1-branch (-r116176:116223)
  - PRs c++/28593, c++/28606, c++/28710, c/27697, middle-end/20256,
	middle-end/25211, middle-end/26435
- don't waste .rodata space when copying from const array with large
  entries (PR middle-end/28755)
- fix --combine with anonymous structures in unions (Alexandre Oliva,
  PR c/27898)
- rebuilt with latest binutils to pick up 64K -z commonpagesize on ppc*
  (#203001)- update from gcc-4_1-branch (-r116082:116176)
  - PRs c++/27894, c++/28677, c/28649, middle-end/28075,
	rtl-optimization/23454
- merge gomp fixes from the trunk (-r116152:116154)
  - PRs middle-end/28713, middle-end/28724
- add -march=geode and -mtune=geode support (Vlad Makarov)
- use %gs rather than %fs register on x86_64 with
  -mcmodel=kernel -fstack-protector (Arjan van de Ven, #202842)
- don't create jar manifest in libgcj-tools-4.*.jar (#200887)
- externally_visible attribute fixes (Jan Hubicka, PRs c/25795, c++/27369)
- --combine fixes for aggregates with attributes (PRs c/28706, c/28712)
- further externally_visible attr fixes (PR c/28744)
- fix invalid token pasting error message (PR preprocessor/28709)
- obey OpenMP 2.5 chapter 4 env var requirements (whitespace rules
  and case insensitivity in the env vars; PR libgomp/28725)
- fix OPT_FLAGS on sparc- fix multilib conflict in libgcj-tools-4.1.1.jar (#200887)- update from gcc-4_1-branch (-r115877:116082)
  - PRs c++/27508, c++/28148, c++/28250, c++/28256, c++/28257, c++/28259,
	c++/28267, c++/28274, c++/28347, c++/28432, c++/28557, c++/28594,
	c++/28637, c++/28638, c++/28639, k@@""ܳRR
RRR
RRRRRR!!9t!9u!!9v!!9w!9x!9y!9z!9{!9|!!9}!9~!9!9ɀ!9Ɂ!9ɂ!9Ƀ!9Ʉ!9Ʌ!9Ɇ!9ɇ!9Ɉ!9ɉ!9Ɋ!9ɋ!9Ɍ!9ɍ!9Ɏ!9ɏ!9ɐ!9ɑ!9ɒ!9ɓ!9s!9ɔ!9ɕ!9ɖ 0 < = 1 2 > 3 4 ? @ A B C D 5 E F G 6 H I J K L 7 M N O 8 P Q R 9 S T U V W X Y Z [ : \ ] ^ ;""""""ܴ""ܷ""""ܸ""ܹ""""""""""""""ܺ""""""""ܻ""""""""""""ܼ""""""""""""""""ܽ"""""""""""""""""
)""ܾ"
*""""""""ܿ#######6##7##8###9#:#;#<##=#>##?#:B##:C#>################$cn$co$c|$cp$c{$c}$c~### #!##"####$#%####&##'#(#)##*#+#,#-###.#####%N%N%N%N%N%N%N%N%N#####/#0#1#2#3#4#5###6#7####8###9#:###;##<#=##>##?#@##A&jw#B&jx#C#D###E##F####G#H##I#J##K##L##M##N#O#P###Q###R####S#T###U#V##W#X#Y#Z###[#\#]##^##_#`###a#b##'x#c'x##d#e#f####g##h#i#j#k#l#m###n##o#p###q##r##s###t#u#v##w#x#y#z#{##|##}(w4#~(wV(wW(w5(wX(w6(wY(w7(w8(w9(wZ(w:(w;(w<(w=(w>(w?(w@(wA(wB(wC(wD(wE(wF(wG(wH(wI(wJ(wK(wL(wM(w[(wN(wO(wP(wQ(wR(wS(wT(wU)T#)T)T*
#*f**;*<*>*?****`*a*b*c*d*e*g#+V#+5+5+V
+V9+V:+5+5+5+V<+V=+V>+V?+5+5+I+5+5+5+J+K+5`+5a+5b+5c+5d+5e+5f+5g+5h+5i+5j+5k+5l+5m+5n+5o+5p+5q+5r+5s+5t+5u+5v+5w+5x+5y+5z+5{+5|+5}+5~+5+5+5+5+5+5+5+5+5+5+5,#,,,,,,,,,,,,,,,,,,,,############-N0-N0-N0-a-e(-e(-e(-e(################################...#####################################//###0
40
50
60
70
8###########################	###
###########
#####1
XF1
XJ1
XK1
XN1
XL1
XM224!4S4T4M4U4N4O4V4Q4R55hkxB@BCAASCII C program textASCII C++ program textASCII English textASCII English text, with very long linesASCII Java program textASCII textASCII text, with very long linesBourne shell script text executableELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippedPaul Falstad's zsh script text executabledirectoryperl script text executable&0:DLT]gowkp@nobody seems to
  be doing it- rebuilt- Add requires libselinux > 1.8- Add MLS Support to selinux patch- Modify pam_selinux to use open and close param- Split pam module into two parts open and close- Fixed 64bit segfault in pam_succeed_if module.- Apply changes from audit.- Change to only report failure on relabel if debug- Fix error handling of pam_unix- rebuilt- fix tty handling- remove tty closing and opening from pam_selinux, it does not work.- rebuilt- pam_unix: also log successful password changes when using shadowed passwords- close and reopen terminal after changing context.- Check for valid tty- Check for multiple > 1- fix is_selinux_enabled call for pam_rootok- More fixes to pam_selinux,pam_rootok- turn on selinux- Fix rootok check.- fix is_selinux_enabled call- Check if ROOTOK for SELinux- Fix tty handling for pts in pam_selinux- Need to add qualifier context for sudo situation- Fix pam_selinux to use prevcon instead of pam_user so it will work for su.- add alsa devs to console.perms- rebuild with db-4.2.52.
- build db4 in build_unix, not dist.- Change unix_chkpwd to handle unix_passwd and unix_acct
- This eliminates the need for pam modules to have read/write access to /etc/shadow.- Cleanup unix_chkpwd- Fix tty handling 
- Add back multiple handling- Remove Multiple from man page of pam_selinux- don't install _pam_aconf.h -- apps don't use it, other PAM headers which
  are installed don't use it, and its contents may be different for arches
  on a multilib system
- check for linkage problems in modules at %install-time (kill #107093 dead)
- add buildprereq on flex (#101563)- make pam_pwdb.so link with libnsl again so that it loads (#107093)
- remove now-bogus buildprereq on db4-devel (we use a bundled copy for
  pam_userdb to avoid symbol collisions with other db libraries in apps)- Add Russell Coker patch to handle /dev/pty- Turn on Selinux- Fix pam_timestamp to work when 0 seconds have elapsed- Turn off selinux- Turn on Selinux and remove multiple choice of context.- Turn off selinux- Add Russell's patch to check password- handle ttys correctly in pam_selinux- Clean up memory problems and fix tty handling.- Add manual context selection to pam_selinux- Add pam_selinux- Add SELinux support- pam_postgresok: add
- pam_xauth: add "targetuser" argument- pam_succeed_if: fix thinko in argument parsing which would walk past the
  end of the argument list- reapply:
  - set handler for SIGCHLD to SIG_DFL around *_chkpwd, not SIG_IGN- pam_timestamp: fail if the key file doesn't contain enough data- update to 0.77 upstream release
  - pam_limits: limits now affect root as well
  - pam_nologin: returns PAM_IGNORE instead of PAM_SUCCESS unless "successok"
    is given as an argument
  - pam_userdb: correctly return PAM_AUTH_ERR instead of PAM_USER_UNKNOWN when
    invoked with the "key_only" argument and the database has an entry of the
    form "user-<wrongpassword>"
- use a bundled libdb for pam_userdb.so because the system copy uses threads,
  and demand-loading a shared library which uses threads into an application
  which doesn't is a Very Bad Idea- pam_timestamp: use a message authentication code to validate timestamp files- rebuild- modify calls to getlogin() to check the directory of the current TTY before
  searching for an entry in the utmp/utmpx file (#98020, #98826, CAN-2003-0388)- rebuilt- set handler for SIGCHLD to SIG_DFL around *_chkpwd, not SIG_IGN- rebuilt- pam_xauth: reintroduce ACL support, per the original white paper
- pam_xauth: default root's export ACL to none instead of everyone- create /lib/security, even if it isn't /%{_lib}/security, because we
  can't locate /lib/security/$ISA without it (noted by Arnd Bergmann)
- clear out the duplicate docs directory created during %install- fix syntax errors in pam_console's yacc parser which newer bison chokes on
- forcibly set FAKEROOT at make install time- patch to interpret $ISA in case the fist module load attempt fails
- use $ISA in default configs- Since crackllo.@..ASCII English textASCII textBourne shell script text executabledirectoryR?p͞dF?UxGV(l?|)<@N{ xߐxBFXDճ$&?UxGV(uALæz[{1JHRA41c92ee1c308ed6e6e9e480e65c961c85716ba86\=;\<uM6|kʥh1?,:HrJ
K,:HrJ
KbJ1PAx@s/ZytO4՘|dJY{{a{(.J;&\a{dye,K2.P}~[tI	{}}~dRfDp8)}>~>GJrl.GzN}~r+1w^z)z*%z0./c3	fMb7Sw}²1'lw6_i*6t=~ȼKZ"2$1%qQ~ffXfktUPpVz*d]=IF7&]'c#, ҩn[^]*@h\\La`s+K++I+^-۶XηwKGQ#C(mfkf#Gx?LLLLLLLLz0aJwKIԤWΫX)/l. U(+x<J 2X|r@ q3߮VnF6oB1Υo{[Ƚw_6ktM-@---edhat.com>Thomas Woerner <twoerner@redhat.com> 8.12.11-3.2Thomas Woerner <twoerner@redhat.com> 8.12.11-3Thomas Woerner <twoerner@redhat.com> 8.12.11-2.1Thomas Woerner <twoerner@redhat.com> 8.12.11-2Thomas Woerner <twoerner@redhat.com> 8.12.11-1.3Thomas Woerner <twoerner@redhat.com> 8.12.11-1.2Thomas Woerner <twoerner@redhat.com> 8.12.11-1.1Thomas Woerner <twoerner@redhat.com> 8.12.11-1Thomas Woerner <twoerner@redhat.com> 8.12.10-7Thomas Woerner <twoerner@redhat.com> 8.12.10-6Florian La Roche <Florian.LaRoche@redhat.de>Jeff Johnson <jbj@jbj.org> 8.12.10-5Florian La Roche <Florian.LaRoche@redhat.de>Karsten Hopp <karsten@redhat.de> 8.12.10-3Karsten Hopp <karsten@redhat.de> Florian La Roche <Florian.LaRoche@redhat.de>Harald Hoyer <harald@redhat.de> 8.12.10-2Jeff Johnson <jbj@jbj.org> 8.12.10-1.2Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com> 8.12.9-6Nalin Dahyabhai <nalin@redhat.com> 8.12.9-5Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Phil Knirsch <pknirsch@redhat.com> 8.12.5-7.2Than Ngo <than@redhat.com> 8.12.5-7.1Florian La Roche <Florian.LaRoche@redhat.de>Phil Knirsch <pknirsch@redhat.com>Phil Knirsch <pknirsch@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 8.12.2-5Bill Nottingham <notting@redhat.com> 8.12.2-3Nalin Dahyabhai <nalin@redhat.com> 8.12.2-2Nalin Dahyabhai <nalin@redhat.com> 8.12.2-1Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 8.11.6-12Bill Nottingham <notting@redhat.com> 8.11.6-11Bernhard Rosenkraenzer <bero@redhat.com> 8.11.6-10Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@vkHTx	@x	w	HE$?D d		A04=D	H`G$$	$
4$$$
	$	$
P$($		k	(8^9^:^>;?;F;G<$H<$I=0$X=TY=X\=l$]=$^?b@]d@e@f@k@l@tA$uA$vB wB$xC`$yC{C$D0D4DDADA
DDD$EgEhE Cgrub0.9713.11.el5_10.1GRUB - the Grand Unified Boot Loader.GRUB (Grand Unified Boot Loader) is an experimental boot loader
capable of booting into most free operating systems - Linux, FreeBSD,
NetBSD, GNU Mach, and others as well as most commercial operating
systems.Rhbuilder10.centos.org9CentOS-5CentOSGPLSystem Environment/Basehttp://www.gnu.org/software/grub/linuxx86_64if [ "$1" = 1 ]; then
  /sbin/install-info --info-dir=/usr/share/info /usr/share/info/grub.info.gz
  /sbin/install-info --info-dir=/usr/share/info /usr/share/info/multiboot.info.gz
fiif [ "$1" = 0 ] ;then
  /sbin/install-info --delete --info-dir=/usr/share/info /usr/share/info/grub.info.gz
  /sbin/install-info --delete --info-dir=/usr/share/info /usr/share/info/multiboot.info.gz
fi	XHS	&FEhR!
X @@  $ <<"EAA큤AA큤RSRTRSRSRSRTRT@e?nB}}B}z?o@z@RSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRS659bc15a378380b60d03974492a0de8aa1edaec3104fc0cf084f8d3fbd30a02e97d4e721589f5984c418afaa22aa8d1129f656b3be384f70a67fd5fc9548730379b279cc0e733243ee7e42958b057a0397bc9401f14faa56ef97e69ea4671fd6c93c0550bd3173f4504b2cbd8991e50bcaf269f6e9ade2edc5bab5e5cddbb5af70086da99fee1fa32b8063d2f6d2b404146457b144451db84cdbe99cd4b57da7296926b7921480bd51ec150b01a80add1871436b39a8f02dd5a7a2684ad0c66d259d281c2ad2f67cf9b1c156511522e9f442ff0dceb05df41e13f0071a7ffcd2ab875d7fbfc830e05fc21f0cc8a9195ac5b241bd68a222fd7f145941ada7534bfd80660c60f466f73615802118607472343864f5009150894eaa2c449efe910d0009bbaae722a4e330a3f4b9728dbc5ec05824e4047360388cf7b71296117e54beb94b7f1605448797f3ae04ab94122711b3c11153f6cfbbec98843aaa7120dff8103b2896eb7e81507ff4ab5e967b77658b8684437c311fa75ea89f1eb5566277c6079ef4b7583cdfb06daeefcbd5b5c32333566a6cc61b347fd4d26f12bb79126523a76f4056486f969b5d84d468ee9456a0774c1202ab501e22f37034d41719cdb3bffda7263ea3968fd2d42e8c135d7d2b1f8330d16d6a16085c44d6b7f0f6dfd183cb5f7465f3be3692a452c86e788ab166e49665d586e5b20552d88b67rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgrub-0.97-13.11.el5_10.1.src.rpm+kP]
@
!#################################################	 











































k0T_-@---an5/aliases.5.gzMTAconfig(sendmail)smtpdaemonsendmail@@@@	@@@@@L@@@@@@@@@@@@@@@@@@@@@@JJJ@@@/bin/bash/bin/mktemp/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/usr/sbin/alternatives/usr/sbin/saslauthd/usr/sbin/useraddbashchkconfigconfig(sendmail)fileutilsgawklibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libcrypto.so.6()(64bit)libdb-4.3.so()(64bit)libhesiod.so.0()(64bit)liblber-2.3.so.0()(64bit)libldap-2.3.so.0()(64bit)libnsl.so.1()(64bit)libnsl.so.1(GLIBC_2.2.5)(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)libsasl2.so.2()(64bit)libssl.so.6()(64bit)libwrap.so.0()(64bit)openldapopensslprocmailrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rpmlib(VersionedDependencies)rtld(GNU_HASH)sedsetupsh-utils2.01.38.13.8-10.el5_113.0.4-14.0-13.0.3-12.5.31-14.4.2.3/sbin/chkconfig --add sendmail/usr/sbin/alternatives --auto mtasendmailsendmail8.10.08.11.6-11T-L`KZKX`KGEl`DD`DDYDpD`D`D!CG`CC`C`CsCJ`C/4B{Bp`B\DB9B0`B$AAVAA~A6F`A`@7@Z`@q`@@ty@m`@l@k?`@k?`@X`@E@51@51@"@0@@G@`@
@@?`?ۋ???"`?`??se`?j*?h`?S`?4`?(???>k>%>>$>>>`>h>">fs`>Z>Z>Z>Ir`>/`>/`>#6>!`> >`=`==b=y=Ŝ`=J=`=`=n`=@t=?#`=?#`=-= ===r<f`<`<`<<`<<<<4`<~`<z<t`<t`<[<Y`<Y`<M<><<`<;;7;;;|;s;o`;];\`;Kz;`:::#`::`::Q`::`:`:oP`:m:_~`:Z8`:T`9`9a`99k91`9<99~
9~
9wv`9l`9h9g`9b^`9]`9S9Q:9MF`9B`9%`9$g9`88o`8o`8`88F7͡7P`7P`77}6`7`7U7	2`666`6k66`6P6`6`5(`5O5K`5JE4W4Q`4F`4<`49_`4(;44i44
3q`3A`3IJaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-10Jaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-9Jaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-8Jaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-7Miroslav Lichvar <mlichvar@redhat.com> 8.13.8-6.el5Thomas Woerner <twoerner@redhat.com> 8.13.8-2Florian La Roche <laroche@redhat.com>Thomas Woerner <twoerner@redhat.com> 8.13.8-1Thomas Woerner <twoerner@redhat.com> 8.13.7-3.1Thomas Woerner <twoerner@redhat.com> 8.13.7-3Jesse Keating <jkeating@redhat.com> - 8.13.7-2.1Thomas Woerner <twoerner@redhat.com> 8.13.7-2Thomas Woerner <twoerner@redhat.com> 8.13.7-1Thomas Woerner <twoerner@redhat.com> 8.13.6-1Thomas Woerner <twoerner@redhat.com> 8.13.5-3Jesse Keating <jkeating@redhat.com> - 8.13.5-2.2.1Jesse Keating <jkeating@redhat.com> - 8.13.5-2.2Jesse Keating <jkeating@redhat.com>Tomas Mraz <tmraz@redhat.com> 8.13.5-2Tomas Mraz <tmraz@redhat.com>Thomas Woerner <twoerner@redhat.com> 8.13.5-1Thomas Woerner <twoerner@redhat.com> 8.13.4-2Thomas Woerner <twoerrner@redhat.com> 8.13.4-1.1Thomas Woerner <twoerner@redhat.com> 8.13.4-1Thomas Woerner <twoerner@redhat.com> 8.13.3-2Jason Vas Dias <jvdias@redhat.com> 8.13.3-1.2Thomas Woerner <twoerner@redhat.com> 8.13.3-1.1Thomas Woerner <twoerner@redhat.com> 8.13.3-1Thomas Woerner <twoerner@redhat.com> 8.13.2-1Jeff Johnson <jbj@jbj.org> 8.13.1-2.2Thomas Woerner <twoerner@redhat.com> 8.13.1-2.1Thomas Woerner <twoerner@redhat.com> 8.13.1-2Thomas Woerner <twoerner@redhat.com> 8.13.1-1Thomas Woerner <twoerner@redhat.com> 8.13.0-1.1Thomas Woerner <twoerner@redhat.com> 8.13.0-1Elliot Lee <sopwith@redhat.com>Dan Walsh <dwalsh@redhat.com> 8.12.11-4.6Dan Walsh <dwalsh@redhat.com> 8.12.11-4.5Thomas Woerner <twoerner@redhat.com> 8.12.11-4.4Thomas Woerner <twoerner@redhat.com> 8.12.11-4.3Thomas Woerner <twoerner@redhat.com> 8.12.11-4.2Thomas Woerner <twoerner@redhat.com> 8.12.11-4.1Thomas Woerner <twoerner@redhat.com> 8.12.11-4Elliot Lee <sopwith@rk@.-@.---/-llard <veillard@redhat.com> - 2.6.26-2.1.12Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.11Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.10Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.9Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.8Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.7Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.6Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.3Jesse Keating <jkeating@redhat.com> - 2.6.26-2.1.2Jesse Keating <jkeating@redhat.com> - 2.6.26-2.1.1Jesse Keating <jkeating@redhat.com> - 2.6.26-2.1Daniel Veillard <veillard@redhat.com> 2.6.26-2Daniel Veillard <veillard@redhat.com> 2.6.26-1Daniel Veillard <veillard@redhat.com>- CVE-2014-3660 denial of service via recursive entity expansion (rhbz#1161841)- fixed one regexp bug and added a (rhbz#922450)
- Another small change on the algorithm for the elimination of epsilon (rhbz#922450)- detect and stop excessive entities expansion upon replacement (rhbz#912573)- fix validation issues with some XSD (rhbz#877348)
- xmlDOMWrapCloneNode discards namespace of the node parameter (rhbz#884707)- fix out of range heap access (CVE-2012-5134)- Implement some default limits in the XPath module (CVE-2011-1944)
- Change the XPath code to percolate allocation errors (CVE-2011-1944)- Fix an off by one pointer access (CVE-2011-3102)- Fix parser local buffers size problems (rhbz#843740)
- Fix entities local buffers size problems (rhbz#843740)
- Fix an error in previous commit (rhbz#843740)- fix previous build to force compilation of randomization code
- Resolves: rhbz#788844- adds randomization to hash and dict structures CVE-2012-0841
- Resolves: rhbz#788844- Fix the semantic of XPath axis for namespace/attribute nodes CVE-2010-4008
- Fix an off by one error in encoding CVE-2011-0216
- Fix some potential problems on reallocation failures CVE-2011-1944
- Fix missing error status in XPath evaluation CVE-2011-2834
- Make sure the parser returns when getting a Stop order CVE-2011-3905
- Fix an allocation error when copying entities CVE-2011-3919.patch
- Resolves: rhbz#771907- fix schemas validation of empty integer values (rhbz#743737)- Fix a potential crasher in XPath or XSLT, CVE-2011-1944
- Resolves: rhbz#710395- fix various problems with XSD validation
- Resolves: rhbz#644312- missing an initialization in an XPath internal structure
- Resolves: rhbz#613860- Fix a couple of crash CVE-2009-2414 and CVE-2009-2416
- Resolves: rhbz#515237- two patches for size overflows problems CVE-2008-4225 and CVE-2008-4226
- Resolves:  rhbz#470475- Patch to fix an entity name copy buffer overflow CVE-2008-3529
- Resolves: rhbz#461024- Patch to fix recursive entities handling CVE-2008-3281 in a better way
- Resolves: rhbz#458096- Patch to fix recursive entities handling CVE-2008-3281
- Resolves: rhbz#458096- Patch to fix UTF-8 decoding problem CVE-2007-6284
- Resolves: rhbz#425934- fixing an i386/x86_64 parallel install problem of -devel
- Resolves: rhbz#222735- rebuild- rebuild- fix bug #192873- upstream release 2.6.26 see http://xmlsoft.org/news.html- upstream release 2.6.25 broken, do not ship !builder17.centos.org 14165106771k`7$@\<rs <timp@redhat.com>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Erik Troan <ewt@redhat.com>- roll in CentOS Branding change to the Spec file- Resolves: #708942
  "while loop cannot quit even if the list after while has failed"- Resolves: #608927
  "busybox grep -Fi" doesn't work as expected
  (-i was ignored)- Resolves: #678701
  kdump fails with "out of string space" error then panics
  (a shell memory leak problem)- Resolves: #500547
  remove empty debuginfo package- Related: #385661
 'diff -q' command returns wrong status- Resolves: #440623
  there should be .el5.centos instead of .el5.centos
- Resolves: #385661
  'diff -q' command returns wrong status
- Resolves: #466896
  fix rpm applet
- Resolves: #480105
  fix uname applet- Resolves: #218851
  add ash shell
- Resolves: #236218
  fix hwclock command on ia64 architecture- fix #200470 - dmesg aborts
  backport dmesg upstream changes- fix #202891 - tar problem- rebuild- update to 1.2.0- fix so that busybox.anaconda has sh- update to 1.1.3- fix Makefile typo (#193354)- update to 1.1.2- add -Z option to id command, rename ps command -Z option (#190534)- update to 1.1.1
- fix CVE-2006-1058 - BusyBox passwd command 
  fails to generate password with salt (#187386)
- add -minimal-toc option
- add RPM_OPT_FLAGS
- remove asm/page.h used sysconf command to get PAGE_SIZE
- add overfl patch to aviod Buffer warning- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Add sepol for linking load_policy- update to 1.01- add debug files to debug_package- rebuilt- update to 1.00 - fix bug #145681
- rebuild- enable ash as the shell in busybox-anaconda- fix segfault in SELinux patch (#134404, #134406)- Fixed double free in freecon() call (#132809)- Add CONFIG_STATIC=y for static builds- rebuild- Add BuildRequires libselinux-devel
- Update to latest from upstream- rebuilt- add mknod to busybox-anaconda- fix LS_COLOR in anaconda patch- add awk to busybox-anaconda- Update with latest patch. 
- Turn off LS_COLOR in static patch- rebuilt- Fix is_selinux_enabled calls-Latest update- Add insmod- Upgrade to pre3- Upgrade selinux support- Upgrade to 1.00 package- Rebuild- rebuild- add dmesg to busybox-anaconda- rebuilt- rebuilt- lost nolock for anaconda mount when rediffing, it returns (#81764)- Upstream developers wanted to eliminate the use of floats- Fix free to work on large memory machines.- update Config.h for anaconda build to include more useful utils- update latest release- incorporate hammer changes- automated rebuild- automated rebuild- fix compilation on mainframe- fix static busybox (#60701)- don't include mknod in busybox.anaconda so we get collage mknod- rebuild in new environment- update to 0.60.2
- include more pieces for the anaconda version so that collage can go away
- make the mount in busybox.anaconda default to -onolock`- automated rebuild- don't obsolete sash
- fix URL and spelling in desc. to satisfy rpmlint- add missing defattr for anaconda subpackage- initial build for Red Hatbuilder10.centos.org 13113228291:1.2.0-10.el5.centosbusyboxbusybox.1.gz/sbin//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mkP1-@1-0-2-ave.htmllibxml2-xmlschemas.htmllibxml2-xmlschemastypes.htmllibxml2-xmlstring.htmllibxml2-xmlunicode.htmllibxml2-xmlversion.htmllibxml2-xmlwriter.htmllibxml2-xpath.htmllibxml2-xpathInternals.htmllibxml2-xpointer.htmllibxml2.devhelpright.pngstyle.cssup.pngxml2-config.1.gz/usr/bin//usr/include//usr/include/libxml2//usr/include/libxml2/libxml//usr/lib64//usr/lib64/pkgconfig//usr/share/aclocal//usr/share/doc//usr/share/doc/libxml2-devel-2.6.26//usr/share/doc/libxml2-devel-2.6.26/examples//usr/share/doc/libxml2-devel-2.6.26/html//usr/share/doc/libxml2-devel-2.6.26/tutorial//usr/share/doc/libxml2-devel-2.6.26/tutorial/images//usr/share/doc/libxml2-devel-2.6.26/tutorial/images/callouts//usr/share/gtk-doc/html//usr/share/gtk-doc/html/libxml2//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnu 
	
ASCII C program textASCII C program text, with CRLF, LF line terminatorsASCII English textASCII make commands textASCII textBourne shell script text executableGIF image data, version 87a, 657 x 418GIF image data, version 87a, 793 x 338GIF image data, version 89a, 180 x 68GIF image data, version 89a, 404 x 241GIF image data, version 89a, 44 x 41GIF image data, version 89a, 48 x 60GIF image datl.@...entproto.mccs-hpux10.mccs-hpux9.mccs-osf1.mccs-solaris2.mccs-sunos4.1.mccs-ultrix4.mccyrusproto.mcgeneric-bsd4.4.cfgeneric-bsd4.4.mcgeneric-hpux10.cfgeneric-hpux10.mcgeneric-hpux9.cfgeneric-hpux9.mcgeneric-linux.cfgeneric-linux.mcgeneric-mpeix.cfgeneric-mpeix.mcgeneric-nextstep3.3.cfgeneric-nextstep3.3.mcgeneric-osf1.cfgeneric-osf1.mcgeneric-solaris.cfgeneric-solaris.mcgeneric-sunos4.1.cfgeneric-sunos4.1.mcgeneric-ultrix4.cfgeneric-ultrix4.mchuginn.cs.mcknecht.mcmail.cs.mcmail.eecs.mcmailspool.cs.mcpython.cs.mcs2k-osf1.mcs2k-ultrix4.mcsubmit.cfsubmit.mctcpproto.mcucbarpa.mcucbvax.mcuucpproto.mcvangogh.cs.mcdomainBerkeley.EDU.m4CS.Berkeley.EDU.m4EECS.Berkeley.EDU.m4S2K.Berkeley.EDU.m4berkeley-only.m4generic.m4featureaccept_unqualified_senders.m4accept_unresolvable_domains.m4access_db.m4allmasquerade.m4always_add_domain.m4authinfo.m4bestmx_is_local.m4bitdomain.m4blacklist_recipients.m4compat_check.m4conncontrol.m4delay_checks.m4dnsbl.m4domaintable.m4enhdnsbl.m4generics_entire_domain.m4genericstable.m4greet_pause.m4ldap_routing.m4limited_masquerade.m4local_lmtp.m4local_no_masquerade.m4local_procmail.m4lookupdotdomain.m4loose_relay_check.m4mailertable.m4masquerade_entire_domain.m4masquerade_envelope.m4msp.m4mtamark.m4no_default_msa.m4nocanonify.m4notsticky.m4nouucp.m4nullclient.m4preserve_local_plus_detail.m4preserve_luser_host.m4promiscuous_relay.m4queuegroup.m4ratecontrol.m4redirect.m4relay_based_on_MX.m4relay_entire_domain.m4relay_hosts_only.m4relay_local_from.m4relay_mail_from.m4smrsh.m4stickyhost.m4use_client_ptr.m4use_ct_file.m4use_cw_file.m4uucpdomain.m4virtuser_entire_domain.m4virtusertable.m4hackcssubdomain.m4m4cf.m4cfhead.m4proto.m4version.m4mailercyrus.m4cyrusv2.m4fax.m4local.m4mail11.m4phquery.m4pop.m4procmail.m4qpage.m4smtp.m4usenet.m4uucp.m4ostypea-ux.m4aix3.m4aix4.m4aix5.m4altos.m4amdahl-uts.m4bsd4.3.m4bsd4.4.m4bsdi.m4bsdi1.0.m4bsdi2.0.m4darwin.m4dgux.m4domainos.m4dragonfly.m4dynix3.2.m4freebsd4.m4freebsd5.m4freebsd6.m4gnu.m4hpux10.m4hpux11.m4hpux9.m4irix4.m4irix5.m4irix6.m4isc4.1.m4linux.m4maxion.m4mklinux.m4mpeix.m4nextstep.m4openbsd.m4osf1.m4powerux.m4ptx2.m4qnx.m4riscos4.5.m4sco-uw-2.1.m4sco3.2.m4sinix.m4solaris2.m4solaris2.ml.m4solaris2.pre5.m4solaris8.m4sunos3.5.m4sunos4.1.m4svr4.m4ultrix4.m4unicos.m4unicosmk.m4unicosmp.m4unixware7.m4unknown.m4uxpds.m4sendmail.schemashmakeinfo.shsiteconfiguucp.cogsci.m4uucp.old.arpa.m4uucp.ucbarpa.m4uucp.ucbvax.m4/usr/share//usr/share/sendmail-cf//usr/share/sendmail-cf/cf//usr/share/sendmail-cf/domain//usr/share/sendmail-cf/feature//usr/share/sendmail-cf/hack//usr/share/sendmail-cf/m4//usr/share/sendmail-cf/mailer//usr/share/sendmail-cf/ostype//usr/share/sendmail-cf/sh//usr/share/sendmail-cf/siteconfig/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuvi(@RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR? JJc{k+!D ¹?MGV(,2jymbi-FLGҤ!k{3=~.?MGV(!WS?p]1|pE+oBCfaCp4cbf3cf64b4b66198a527fbf32838e3f6747ea22O2
XO1
&5BQ^mz"1>L[hw-:IVds(7DS`o|	$2AN]jy /<KXgt*9FUbq~
		&	5	C	P	_	l	z										

#
0
?
L
Z
i
v









,:HWds
)6ERan|

$
2
@
O
\
k
x









"/>KYgu+:GVcq'6CQ`m|#2?M\ix -;JXes
)8ESap}
&3BP^kzLC_IDENTIFICATIONui0@(((((y((((((|(((z((((((((0.6.1-4.el5	

	
dogtail-detect-sessiondogtail-recorderdogtail-run-headlesssniffdogtail__init__.py__init__.pyc__init__.pyoconfig.pyconfig.pycconfig.pyodistro.pydistro.pycdistro.pyodump.pydump.pycdump.pyoerrors.pyerrors.pycerrors.pyoi18n.pyi18n.pyci18n.pyologging.pylogging.pyclogging.pyopath.pypath.pycpath.pyopredicate.pypredicate.pycpredicate.pyoprocedural.pyprocedural.pycprocedural.pyorawinput.pyrawinput.pycrawinput.pyotc.pytc.pyctc.pyotrayicon.pytrayicon.pyctrayicon.pyotree.pytree.pyctree.pyoutils.pyutils.pycutils.pyoversion.pyversion.pycversion.pyodogtail-recorder.desktopfedora-sniff.desktopdogtail-0.6.1COPYINGREADMEexamplesdata10b.png10w.png20b.png20w.pngUTF-8-demo.txtsample.cfgfilechooser-stress-test.pygedit-test-utf8-procedural-api.pygedit-test-utf8-tree-api.pyi18n-test.pyno-help-at-all.pytest-events.pydogtailgladerecorder.gladesniff.gladeiconsbutton.xpmcheckbutton.xpmcheckmenuitem.xpmcolorselection.xpmcombo.xpmdialog.xpmimage.xpmlabel.xpmmenubar.xpmmenuitem.xpmnotebook.xpmscrolledwindow.xpmspinbutton.xpmstatusbar.xpmtable.xpmtext.xpmtoolbar.xpmtree.xpmtreeitem.xpmunknown.xpmviewport.xpmvscrollbar.xpmvseparator.xpmwindow.xpm48x48appsdogtail-head-48.pngdogtail-tail-48.pngscalableappsdogtail-head.svgdogtail-tail.svg/usr/bin//usr/lib/python2.4/site-packages//usr/lib/python2.4/site-packages/dogtail//usr/share/applications//usr/share/doc//usr/share/doc/dogtail-0.6.1//usr/share/doc/dogtail-0.6.1/examples//usr/share/doc/dogtail-0.6.1/examples/data//usr/share//usr/share/dogtail//usr/share/dogtail/glade//usr/share/dogtail/icons//usr/share/icons/hicolor//usr/share/icons/hicolor/48x48//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/scalable//usr/share/icons/hicolor/scalable/apps/-O2cpiogzip9noarchnoarch-redhat-linux-gnu








																								





ASCII C++ program textASCII English textASCII Java program textASCII textPNG image data, 10 x 10, 8-bit/color RGB, non-interlacedPNG image data, 20 x 20, 8-bit/color RGB, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedUTF-8 Unicode Java program textX pixmap image textXML document texta /usr/bin/python script text executablea python script text executabledirectory	

 !"#$%&'()*+,-./01234j:@:;9PI debug statement (Stefan Assmann ) [524787]
- [s390] AF_IUCV SOCK_SEQPACKET support (Hans-Joachim Picht ) [512006]
- [x86] fix nosmp option (Prarit Bhargava ) [509581]
- [nfs] nfsd4: idmap upcalls should use unsigned uid/gid (Jeff Layton ) [519184]
- [ia64] fix ppoll and pselect syscalls (Prarit Bhargava ) [520867]
- [net] ipv4: ip_append_data handle NULL routing table (Jiri Pirko ) [520297]
- [net] fix drop monitor to not panic on null dev (Neil Horman ) [523279]
- [gfs2] gfs2_delete_inode failing on RO filesystem (Abhijith Das ) [501359]
- [nfs] statfs error-handling fix (Jeff Layton ) [519112]
- [pci] avoid disabling acpi to use non-core PCI devices (Mauro Carvalho Chehab ) [504330]
- [nfs] fix regression in nfs_open_revalidate (Jeff Layton ) [511278]
- [nfs] fix cache invalidation problems in nfs_readdir (Jeff Layton ) [511170]
- [fs] sanitize invalid partition table entries (Stefan Assmann ) [481658]
- [char] fix corrupted intel_rng kernel messages (Jerome Marchand ) [477778]
- [net] ipv6: do not fwd pkts with the unspecified saddr (Jiri Pirko ) [517899]
- [ata] ahci: add device ID for 82801JI sata controller (David Milburn ) [506200]
- [misc] support Intel multi-APIC-cluster systems (Prarit Bhargava ) [507333]
- [ext3] fix online resize bug (Josef Bacik ) [515759]
- [xen] netback: call netdev_features_changed (Herbert Xu ) [493092]
- [net] igbvf: recognize failure to set mac address (Stefan Assmann ) [512469]
- [misc] documentation: fix file-nr definition in fs.txt (Danny Feng ) [497200]
- [misc] cpufreq: don't set policy for offline cpus (Prarit Bhargava ) [511211]
- [net] sunrpc client: IF for binding to a local address (Jeff Layton ) [500653]
- [fs] nlm: track local address and bind to it for CBs (Jeff Layton ) [500653]
- [net] sunrpc: set rq_daddr in svc_rqst on socket recv (Jeff Layton ) [500653]
- [cpufreq] P-state limit: limit can never be increased (Stanislaw Gruszka ) [489566]
- [crypto] s390: permit weak keys unless REQ_WEAK_KEY set (Jarod Wilson ) [504667]
- [fs] procfs: fix fill all subdirs as DT_UNKNOWN (Danny Feng ) [509713]
- [block] ll_rw_blk: more flexable read_ahead_kb store (Danny Feng ) [510257]
- [audit] correct the record length of execve (Amerigo Wang ) [509134]
- [net] tcp: do not use TSO/GSO when there is urgent data (Danny Feng ) [502572]
- [net] vxge: new driver for Neterion 10Gb Ethernet (Michal Schmidt ) [453683]
- [net] vxge: Makefile, Kconfig and config additions (Michal Schmidt ) [453683]
- [pci] add PCI Express link status register definitions (Michal Schmidt ) [453683]
- [net] 8139too: RTNL and flush_scheduled_work deadlock (Jiri Pirko ) [487346]
- [x86] suspend-resume: work on large logical CPU systems (John Villalovos ) [499271]
- [gfs2] '>>' does not update ctime,mtime on the file (Abhijith Das ) [496716]
- [net] icmp: fix icmp_errors_use_inbound_ifaddr sysctl (Jiri Pirko ) [502822]
- [nfs] fix stripping SUID/SGID flags when chmod/chgrp dir (Peter Staubach ) [485099]
- [net] bonding: allow bond in mode balance-alb to work (Jiri Pirko ) [487763]
- [x86] fix mcp55 apic routing (Neil Horman ) [473404]
- [net] rtl8139: set mac address on running device (Jiri Pirko ) [502491]
- [net] tun: allow group ownership of TUN/TAP devices (Jiri Pirko ) [497955]
- [net] tcp: do not use TSO/GSO when there is urgent data (Jiri Olsa ) [497032]
- [misc] undefined reference to `__udivdi3' (Amerigo Wang ) [499063]- [scsi] st.c: memory use after free after MTSETBLK ioctl (David Jeffery ) [520192]
- [nfs] knfsd: fix NFSv4 O_EXCL creates (Jeff Layton ) [524521] {CVE-2009-3286}
- [net] r8169: balance pci_map/unmap pair, use hw padding (Ivan Vecera ) [515857]
- [net] tc: fix unitialized kernel memory leak (Jiri Pirko ) [520863]
- [misc] kthreads: kthread_create vs kthread_stop() race (Oleg Nesterov ) [440273]
- [net] fix unbalance rtnl locking in rt_secret_reschedule (Neil Horman ) [510067]- [x86_64] kvm: bound last_kvm to prevent backwards time (Glauber Costa ) [524076]
- [x86] kvm: fix vsyscall going backwards (Glauber Costa ) [524076]
- [misc] fix RNG to not use first genejx@rep time (Jarod Wilson) [687950]- [block] cciss: use short tags where supported (Tomas Henzl) [656343]
- [block] cciss: Fix memory leak in cciss_sysfs_stat_inquiry (Tomas Henzl) [656343]
- [block] cciss: do not reorder commands in internal queue (Tomas Henzl) [656343]
- [block] cciss: add another controller 0x103C3356 (Tomas Henzl) [656343]
- [block] cciss: fix panic in cciss_revalidate (Tomas Henzl) [656343]
- [block] cciss: Do not remove /proc entry if we never created it (Tomas Henzl) [656343]
- [block] cciss: do not leak stack to userland (Tomas Henzl) [656343]
- [block] cciss: catch kmalloc failure of h->scatter_list (Tomas Henzl) [656343]
- [block] cciss: fix missed command status value CMD_UNABORTABLE (Tomas Henzl) [656343]
- [block] cciss: remove ifdef'ed out interrupt_not_for_us (Tomas Henzl) [656343]
- [block] cciss: change printks to dev_warn (Tomas Henzl) [656343]
- [block] cciss: use consistent variable names (Tomas Henzl) [656343]
- [block] cciss: mark performant mode function as __devinit (Tomas Henzl) [656343]
- [block] cciss: cleanup some debug ifdefs (Tomas Henzl) [656343]
- [block] cciss: fix leak of ioremapped memory in init error path (Tomas Henzl) [656343]
- [block] cciss: Fix panic in multipath configurations (Tomas Henzl) [656343]
- [message] mptfusion: version update to 3.04.18rh (Tomas Henzl) [662160]
- [message] mptfusion: Incorrect return value in mptscsih_dev_reset (Tomas Henzl) [662160]
- [message] mptfusion: remove bus reset (Tomas Henzl) [662160]
- [message] mptfusion: 3gbps - 6gbps (Tomas Henzl) [662160]
- [message] mptfusion: sysfs sas addr handle (Tomas Henzl) [662160]
- [message] mptfusion: Fix 32 bit platforms with 64 bit resources (Tomas Henzl) [662160]
- [message] mptfusion: use module_param correctly (Tomas Henzl) [662160]
- [message] mptfusion: Adjust confusing if indentation (Tomas Henzl) [662160]
- [message] mptfusion: print Doorbell reg on hard reset and timeout (Tomas Henzl) [662160]
- [message] mptfusion: Cleanup some duplicate calls in mptbase.c (Tomas Henzl) [662160]
- [message] mptfusion: Extra DMD error handling debug prints (Tomas Henzl) [662160]
- [message] mptfusion: block errors if deleting devices or DMD (Tomas Henzl) [662160]
- [message] mptfusion: add ioc_reset_in_progress reset in SoftReset (Tomas Henzl) [662160]
- [message] mptfusion: handle SATA hotplug failure (Tomas Henzl) [662160]
- [message] mptfusion: schedule_target_reset from all Reset context (Tomas Henzl) [662160]
- [message] mptfusion: sanity check for device before adding to OS (Tomas Henzl) [662160]
- [message] mptfusion: fix declaration of device_missing_delay (Tomas Henzl) [662160]
- [message] mptfusion: DID_TRANSPORT_DISRUPTED, not DID_BUS_BUSY (Tomas Henzl) [662160]
- [message] mptfusion: Set fw_events_off to 1 at driver load time (Tomas Henzl) [662160]
- [scsi] mpt2sas: version change to 08.101.00.00 (Tomas Henzl) [662153]
- [scsi] mpt2sas: Call _scsih_ir_shutdown before reporting to OS (Tomas Henzl) [662153]
- [scsi] mpt2sas: Basic Code Cleanup in mpt2sas_base (Tomas Henzl) [662153]
- [scsi] mpt2sas: fix access to freed memory from port enable (Tomas Henzl) [662153]
- [scsi] mpt2sas: Fix race between broadcast asyn event (Tomas Henzl) [662153]
- [scsi] mpt2sas: support for Customer specific branding messages (Tomas Henzl) [662153]
- [scsi] mpt2sas: Revision P MPI Header Update (Tomas Henzl) [662153]
- [scsi] mpt2sas: Correct resizing calculation for max_queue_depth (Tomas Henzl) [662153]
- [scsi] mpt2sas: device reset event not supported on old firmware (Tomas Henzl) [662153]
- [scsi] mpt2sas: fix device removal handshake with vacant bit set (Tomas Henzl) [662153]
- [scsi] mpt2sas: Debug string changes from target to device (Tomas Henzl) [662153]
- [scsi] mpt2sas: Remove code for TASK_SET_FULL from driver (Tomas Henzl) [662153]
- [scsi] mpt2sas: MPI2.0 Header updated (Tomas Henzl) [662153]
- [scsi] mpt2sas: Modify code to support Expander switch (Tomas Henzl) [662153]
- [scsi] mpt2sas: create pool of chain buffers for IO (Tomas Henzl) [662153]
- [scsi] mpt2sas: add lok0t	>,@>,=,?,94-1Havoc Pennington <hp@redhat.com> 0.6.93-1Havoc Pennington <hp@redhat.com> 0.6.92-1Havoc Pennington <hp@redhat.com> 0.6.91-1Havoc Pennington <hp@redhat.com> 0.6.90-1- Revert the -doc split as the original bug was closed with WONTFIX
- Ensure unreleased changes are reverted from dist-git.
- Resolves: #752493- Close all file descriptors 3 and up before auto-launching the dbus daemon.
- Resolves: #517169- Remove the epoch from the Requires line for the doc subpackage.
- Resolves: #752493- Split out a -docs subpackage to fix a multiarch bug.
- Resolves: #752493- CVE-2011-2200
- Resolves: #725312- Ensure that a everything install of RHEL 5.6 can update to 5.7 by
  obsoleting old versons of dbus prior to the -libs split.
- NOTE: this reverts a part of dcbw's 1.1.2-12, it turns out it is
  actually needed after all. I suppose is was before rel-eng blocked
  the 32 bit package.
- Resolves: #701941- Fix for CVE-2010-4352
- Resolves: #684851- CVE-2009-1189 dbus: invalid fix for CVE-2008-3834- Fix multilib conflicts in dbus-devel
- Resolves: #471359- Fix for CVE-2008-3834
- Resolves: #466227
- Remove dbus-libs Obsoletes on dbus; not needed
- Resolves: #466007- Specify D-Bus user ID when adding user to /etc/passwd
- Resolves: #463278- Fix D-Bus user ID in system bus config file
- Resolves: #463278- Update to 1.1.2
- Resolves: #455791- Fix pthread locking issue
- Resolves: #431671- Fix sending messages to audit subsystem
- Resolves: #439810- CVE-2008-0595: D-Bus security policy circumvention
- Resolves: #432438- CVE-2006-6107: D-Bus denial of service
- Resolves: #219601Resolves: #217721
- Don't die on SIGHUP when rereading config file, if it's no
  longer compatible with the version of the bus running- Add /var/lib/dbus directory to %files 
- Resolves: bz 216454- add patch to fix dbus_threads_init_default- update to D-Bus 1.0.0 "Blue Bird"
- build tests, asserts and verbose mode off
- patch so we are not fatal when checks fail- rebuilt for unwind info generation, broken in gcc-4.1.1-21- Add a Requires for libxml2-python (#201877)- Updated from upstream D-Bus 1.0 RC 1 (0.93)- Only audit on the system bus- Update to 0.92 
- remove old patches- add patch to fix timeout removal assertion- add patch to fix taking a connection ref when it is locked- change the arch-deps.h include directory to /usr/lib[64] instead of /lib[64]
  in the dbus-1.pc file after compile- Move arch include file from lib to libdir- add patch that pregenerates the xml introspect file so d-bus doesn't
  have to be running suring the build.- s/--libdir=\/lib/--libdir=% {_lib}/ in configure stage
- add / before % {_lib}- Remove some remnants of the GLIB bindings from configure.in- Update to upstream 0.90
- Split out bindings- rebuild- Update to upstream 0.62
- Remove mono for s390s- Rebuild- add buildrequires libICE-devel, libSM-devel, libcap-devel
- change buildrequires form libX11 to libX11-devel- Bump and rebuild.  Add a BR and R for libX11- Backport patch from dbus-connection.c
  - Allows interfaces to be NULL in the message header as per the spec
  - Fixes a problem with pendings calls blocking on a data starved socket- New audit patch- ABI hasn't changed so add patch that makes dbus-sharp think
  it is still 0.60 (mono uses hard version names so any change
  means apps need to recompile)- Make sure chkconfig rests the priorities so we can start earlier- Upgrade to upstream version 0.61
- remove python callchain patch
- update avc patch- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Add patch to fix the python callchain
- Symlink dbus-send to /usr/bin because some applications
  look for it there- Fix up patch to init script so it refrences /bin not /usr/bin- move base libraries and binaries to /bin and /lib so they can be started
  before /usr is mounted on network mounted /usr systems
- have D-Bus start early- mono now built on s390x- Don't exclude non-mono arches- Add dbus-sharp sub-package- rebuilt- upgrade to 0.60- upgrade to l .@....pre9.2.1Harald Hoyer <harald@redhat.com> 3.2-0.pre9.2Jesse Keating <jkeating@redhat.com>Florian La Roche <laroche@redhat.com>Bill Nottingham <notting@redhat.com> 3.2-0.pre7.3Bill Nottingham <notting@redhat.com> 3.2-0.pre7.2Bill Nottingham <notting@redhat.com> 3.2-0.pre7.1Bill Nottingham <notting@redhat.com> 3.1-3Bill Nottingham <notting@redhat.com> 3.1-2Bill Nottingham <notting@redhat.com> 3.1-1Jeremy Katz <katzj@redhat.com> - 3.1-0.pre5.4Bill Nottingham <notting@redhat.com> 3.1-0.pre5.3Bill Nottingham <notting@redhat.com> 3.1-0.pre5.2Bill Nottingham <notting@redhat.com> 3.1-0.pre5.1Bill Nottingham <notting@redhat.com> 3.0-2Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com> 3.0-0.pre10.1Bill Nottingham <notting@redhat.com> 2.4.26-16Bill Nottingham <notting@redhat.com> 2.4.26-15Bill Nottingham <notting@redhat.com> 2.4.26-14Steve Dickson <SteveD@RedHat.com>Steve Dickson <SteveD@RedHat.com>Steve Dickson <SteveD@RedHat.com>Bill Nottingham <notting@redhat.com> 2.4.26-9Bill Nottingham <notting@redhat.com> 2.4.26-7Bill Nottingham <notting@redhat.com> 2.4.26-6Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com> 2.4.26-3Bill Nottingham <notting@redhat.com> 2.4.26-2Bill Nottingham <notting@redhat.com> 2.4.26-1Bill Nottingham <notting@redhat.com> 2.4.25-13Bill Nottingham <notting@redhat.com> 2.4.25-12Bill Nottingham <notting@redhat.com> 2.4.25-11Bill Nottingham <notting@redhat.com> 2.4.25-10Bill Nottingham <notting@redhat.com> 2.4.25-9Bill Nottingham <notting@redhat.com> 2.4.25-8Bill Nottingham <notting@redhat.com> 2.4.25-6Bill Nottingham <notting@redhat.com> 2.4.25-5Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com> 2.4.25-2Bill Nottingham <notting@redhat.com> 2.4.25-1Bill Nottingham <notting@redhat.com> 2.4.22-10Bill Nottingham <notting@redhat.com> 2.4.22-9Bill Nottingham <notting@redhat.com> 2.4.22-8Bill Nottingham <notting@redhat.com> 2.4.22-7Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Bill Nottingham <notting@redhat.com> 2.4.22-4Bill Nottingham <notting@redhat.com> 2.4.22-3Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 2.4.22-1Bill Nottingham <notting@redhat.com> 2.4.21-1Bill Nottingham <notting@redhat.com> 2.4.18-2Bill Nottingham <notting@redhat.com> 2.4.18-1Bill Nottingham <notting@redhat.com> 2.4.16-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bill Nottingham <notting@redhat.com> 2.4.14-3Bill Nottingham <notting@redhat.com> 2.4.14-2Bill Nottingham <notting@redhat.com> 2.4.14-1Bill Nottingham <notting@redhat.com> 2.4.13-7/8Bill Nottingham <notting@redhat.com> 2.4.13-5Bill Nottingham <notting@redhat.com> 2.4.13-4Bill Nottingham <notting@redhat.com> 2.4.13-3Bill Nottingham <notting@redhat.com> 2.4.13-1Bill Nottingham <notting@redhat.com> 2.4.12-9Bill Nottingham <notting@redhat.com> 2.4.12-8Bill Nottingham <notting@redhat.com> 2.4.12-7Bill Nottingham <notting@redhat.com> 2.4.12-6Bill Nottingham <notting@redhat.com> 2.4.12-5Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Karsten Hopp <karsten@redhat.de>Elliot Lee <sopwith@redhat.com> 2.4.5-3Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>BiljP<88@897emory (Bhavna Sarathy ) [514910]- [scsi] mptsas: fix max_id initialization (mchristi@redhat.com ) [455678]
- [ata] ahci: add IDs for Ibex Peak ahci controllers (David Milburn ) [513067]
- [scsi] lpfc: update to 8.2.0.48.2p, fix multiple panics (Rob Evers ) [512266]
- [gfs2] remove dcache entries for remote deleted inodes (Benjamin Marzinski ) [505548]
- [alsa] add native support for IbexPeak audio (Jaroslav Kysela ) [509526]
- [alsa] IbexPeak related patches for codec auto-config (Jaroslav Kysela ) [509526]
- [scsi] cciss: call bus_unregister in cciss_remove_one (Rob Evers ) [513070]
- [scsi] cciss: add driver sysfs entries (Rob Evers ) [513070]
- [net] e1000e/igb: make sure wol can be configured (Andy Gospodarek ) [513032]
- [fs] xfs: only compile for x86_64 (Eric Sandeen ) [512827]
- [ahci] add SATA GEN3 related messages (David Milburn ) [512086]
- [net] tun/tap: open /dev/net/tun and then poll() it fix (Danny Feng ) [512286] {CVE-2009-1897}
- [net] mlx4_en: problem with LRO that segfaults KVM host (Doug Ledford ) [510789]
- [openib] mthca: fix over sized kmalloc usage (Doug Ledford ) [508902]
- [s390] zcrypt: request gets timed out under high load (Hans-Joachim Picht ) [511289]- [scsi] cciss: fix sysfs broken symlink regression (Rob Evers ) [510178]
- [kabi] add consume_skb (Jon Masters ) [479200]
- [net] ipv6: fix incorrect disable_ipv6 behavior (jolsa@redhat.com ) [512258]
- [net] ipv6: fix BUG when disabled module is unloaded (jolsa@redhat.com ) [512258]
- [net] ipv6: add 'disable' module parameter support (jolsa@redhat.com ) [512258]
- Revert: [mm] fix swap race in fork-gup patch group (Larry Woodman ) [508919]
- [scsi] mptfusion: fix OOPS in failover path (Rob Evers ) [504835]
- [scsi] stex: minimize DMA coherent allocation (David Milburn ) [486466]
- [misc] personality handling: fix PER_CLEAR_ON_SETID (Vitaly Mayatskikh ) [508842]
- [misc] build with -fno-delete-null-pointer-checks (Eugene Teo ) [511181]
- [scsi] qla2xxx: provide reset capability for EEH (Marcus Barrow ) [511141]
- [scsi] bnx2i: fix host setup and libiscsi abort locking (mchristi@redhat.com ) [511096]
- [xen] ia64: fix rmmod of PCI devices (Chris Lalancette ) [507520]
- [pci] kvm: PCI FLR support for device assignment (Don Dutile ) [510805]
- [gfs2] don't put unlikely reclaim glocks on reclaim list (Benjamin Marzinski ) [504335]- [s390] add missing kernel option CONFIG_SHARED_KERNEL (Hans-Joachim Picht ) [506947]
- [gfs2] fix incorrent statfs_slow consistency check (Benjamin Marzinski ) [505171]
- [net] be2net: fix msix performance regression (Andy Gospodarek ) [510008]
- [gfs2] umount.gfs2 hangs eating CPU (Abhijith Das ) [508876]
- [block] protect the per-gendisk partition array with rcu (Jeff Moyer ) [495866]
- [net] igb: fix panic when assigning device to guest (Andy Gospodarek ) [507173]
- [ia64] xen: dom0 get/set_address_size (Chris Lalancette ) [510069]
- [x86] fix suspend/resume issue on SB800 chipset (Bhavna Sarathy ) [498135]
- [scsi] cciss: fix spinlock (Tomas Henzl ) [509818]
- [scsi] qla2xxx: NPIV broken for PPC, endian fix (Marcus Barrow ) [510268]
- [scsi] qla2xxx: prevent hangs in extended error handling (Marcus Barrow ) [470510]
- [mm] prevent softlockups in copy_hugetlb_page_range (Larry Woodman ) [508919]
- [scsi] cxgb3i: fix vlan support (mchristi@redhat.com ) [508409]
- [net] bnx2i: RHEL-5.4 code cleanups (mchristi@redhat.com ) [504181]
- [x86_64] import asm/svm.h and asm/vmx.h (Eduardo Habkost ) [507483]
- [x86_64] import asm/virtext.h (Eduardo Habkost ) [507483]
- [x86_64] add MSR_VM_* defines (Eduardo Habkost ) [507483]
- [x86_64] disable VMX and SVM on machine_crash_shutdown (Eduardo Habkost ) [507483]
- [x86_64] add EFER_SVME define (Eduardo Habkost ) [507483]
- [x86_64] define X86_CR4_VMXE (Eduardo Habkost ) [507483]
- [net] qlge: rhel-5.4 cleanups (Marcus Barrow ) [509647]
- [scsi] lpfc: fix ctx_idx increase and update version (Rob Evers ) [509010]
- [scsi] lpfc: move pointer ref. inside alloc check in (Rob Evers ) [509010]
- [scsi] lpfc: update to version 8.2.0.48 (Rob Evers ) [509010]
- k0w@k`SZ@Z[Yul Nasrat <pnasrat@redhat.com> - 4.4.2-20Paul Nasrat <pnasrat@redhat.com> - 4.4.2-19Paul Nasrat <pnasrat@redhat.com> - 4.4.2-18Jeremy Katz <katzj@redhat.com> - 4.4.2-17Paul Nasrat <pnasrat@redhat.com> - 4.4.2-16Jesse Keating <jkeating@redhat.com> - 4.4.2-15.2Jesse Keating <jkeating@redhat.com> - 4.4.2-15.1Paul Nasrat <pnasrat@redhat.com> - 4.4.2-15Paul Nasrat <pnasrat@redhat.com> - 4.4.2-14Paul Nasrat <pnasrat@redhat.com> - 4.4.2-13Alexander Larsson <alexl@redhat.com> - 4.4.2-12Paul Nasrat <pnasrat@redhat.com> - 4.4.2-11Paul Nasrat <pnasrat@redhat.com> - 4.4.2-10Paul Nasrat <pnasrat@redhat.com> - 4.4.2-9Paul Nasrat <pnasrat@redhat.com> - 4.4.2-8Tomas Mraz <tmraz@redhat.com> - 4.4.2-7Florian La Roche <laroche@redhat.com>Paul Nasrat <pnasrat@redhat.com> - 4.4.2-5Paul Nasrat <pnasrat@redhat.com> - 4.4.2-4Paul Nasrat <pnasrat@redhat.com> - 4.4.2-3Paul Nasrat <pnasrat@redhat.com> - 4.4.2-2Paul Nasrat <pnasrat@redhat.com> - 4.4.2-1Paul Nasrat <pnasrat@redhat.com> - 4.4.1-21Paul Nasrat <pnasrat@redhat.com> - 4.4.1-20Paul Nasrat <pnasrat@redhat.com> - 4.4.1-19Paul Nasrat <pnasrat@redhat.com> - 4.4.1-18.1Paul Nasrat <pnasrat@redhat.com> - 4.4.1-18Paul Nasrat <pnasrat@redhat.com> - 4.4.1-17Paul Nasrat <pnasrat@redhat.com> - 4.4.1-16Paul Nasrat <pnasrat@redhat.com> - 4.4.1-15Paul Nasrat <pnasrat@redhat.com> - 4.4.1-14Paul Nasrat <pnasrat@redhat.com> - 4.4.1-13Miloslav Trmac <mitr@redhat.com> - 4.4.1-12Paul Nasrat <pnasrat@redhat.com> - 4.4.1-11Jeremy Katz <katzj@redhat.com> - 4.4.1-10Thomas Woerner <twoerner@redhat.com> 4.4.1-9Paul Nasrat <pnasrat@redhat.com> 4.4.1-8Jeff Johnson <jbj@jbj.org> 4.4.1-7Jeremy Katz <katzj@redhat.com> - 4.4.1-6Jeremy Katz <katzj@redhat.com> - 4.4.1-5Jeremy Katz <katzj@redhat.com> - 4.4.1-4Jeremy Katz <katzj@redhat.com> - 4.4.1-3Jeff Johnson <jbj@jbj.org> 4.4.1-1Jeff Johnson <jbj@jbj.org> 4.4.1-0.24Jeff Johnson <jbj@jbj.org> 4.4.1-0.22Jeff Johnson <jbj@jbj.org> 4.4.1-0.20Jeff Johnson <jbj@jbj.org> 4.4.1-0.16Jeff Johnson <jbj@jbj.org> 4.4.1-0.14Jeff Johnson <jbj@jbj.org> 4.4.1-0.12Jeff Johnson <jbj@jbj.org> 4.4.1-0.10Jeff Johnson <jbj@jbj.org> 4.4.1-0.8Jeff Johnson <jbj@jbj.org> 4.4.1-0.7Jeff Johnson <jbj@jbj.org> 4.4.1-0.6Jeff Johnson <jbj@jbj.org> 4.4.1-0.5Jeff Johnson <jbj@jbj.org> 4.4.1-0.3Jeff Johnson <jbj@jbj.org> 4.4.1-0.2Jeff Johnson <jbj@jbj.org> 4.4.1-0.1- Fix warning when applying the patch for #1163057- Fix race condidition where unchecked data is exposed in the file system
  (CVE-2013-6435)(#1163057)- Fix segfault on rpmdb addition when header unload fails (#706935)
- Fix segfault on invalid OpenPGP packet (#743203)- Account for excludes and hardlinks wrt payload max size (#716853)
- Fix payload size tag generation on big-endian systems (#648516)- Track all install failures within a transaction (#671194)- fix changelog (bug #707677 is actually #808547)- Document -D and -E options in man page (#814602)
- Require matching arch for freshen on colored transactions (#813282)- Add DWARF 3 and 4 support to debugedit (#808547)
- No longer add \n to group tag in Python bindings (#783451)
- Fix typos in Japanese rpm man page (#760552)
- Bump Geode compatibility up to i686 (#620570)- Proper region tag validation on package/header read (CVE-2012-0060)
- Double-check region size against header size (CVE-2012-0061)
- Validate negated offsets too in headerVerifyInfo() (CVE-2012-0815)- Revert fix for #740291, too many packages rely on the broken behavior- Add support for XZ-compressed sources and patches to rpmbuild (#620674)
- Avoid unnecessary assert-death when closing NULL fd (#573043)
- Add scriptlet error notification callbacks (#533831)- Honor --noscripts for pre- and posttrans scriptlets too (#740345)
- Avoid bogus error on printing empty ds from python (#628883)
- File conflicts correctness & consistency fixes (#740291)
- Create the directory used for transaction lock if necessary (#510469)
- Only enforce default umask during transaction (#673821)- fix thinko in the CVE backport- fix CVE-2011-3378 (#742157k	@bit platforms.- BuildRequires xorg-x11-devel- Rebuild- Upgrade to 2.1.9
- Since we are just using automake for aclocal, use it unversioned,
  instead of specifying 1.4.- rebuilt- Add patch from freetype CVS to fix problem with eexec (#117743)
- Add freetype-devel to buildrequires and -devel requires
  (Maxim Dzumanenko, #111108)- Added -fno-strict-aliasing to CFLAGS and CXXFLAGS to try to fix SEGV and
  SIGILL crashes in mkfontscale which have been traced into freetype and seem
  to be caused by aliasing issues in freetype macros (#118021)- rebuilt- rebuilt- Upgrade to 2.1.7- allow compiling without the demos as that requires XFree86
  (this allows bootstrapping XFree86 on new archs)- Rebuilt- Bump for rebuild- Fix crash with non-format-0 hdmx tables (found by David Woodhouse)- Version 2.1.4
- Relibtoolize to get deplibs right for x86_64
- Use autoconf-2.5x for freetype-1.4 to fix libtool-1.5 compat problem (#91781)
- Relativize absolute symlinks to fix the -debuginfo package 
  (#83521, Mike Harris)- rebuilt- fix build with gcc 3.3- Add a memleak fix for the gzip backend from Federic Crozat- Run libtoolize/aclocal/autoconf so that libtool knows to generate shared libraries 
  on ppc64.
- Use _smp_mflags (for freetype 2.x only)- Switch to using %configure (should fix #82330)- rebuilt- Make FreeType robust against corrupt fonts with recursive composite 
  glyphs (#74782, James Antill)- Add a patch to implement FT_LOAD_TARGET_LIGHT
- Fix up freetype-1.4-libtool.patch- Update to freetype 2.1.3
- Removed ttmkfdir sources and patches, as they have been moved from the
  freetype packaging to XFree86 packaging, and now to the ttmkfdir package
- Removed patches that are now included in 2.1.3:
  freetype-2.1.1-primaryhints.patch, freetype-2.1.2-slighthint.patch,
  freetype-2.1.2-bluefuzz.patch, freetype-2.1.2-stdw.patch,
  freetype-2.1.2-transform.patch, freetype-2.1.2-autohint.patch,
  freetype-2.1.2-leftright.patch
- Conditionalized inclusion of freetype 1.4 library.- disable perl, it is not used at all- Instead of removing unpackaged file, include it in the package.- Attempted to fix lib64 issue in freetype-demos build with X11_LINKLIBS
- Cleaned up various _foodir macros throughtout specfile
- Removed with_ttmkfdir build option as it is way obsolete- remove unpackaged files from the buildroot- Fix a bug with PCF metrics- Backport autohinter improvements from CVS- Fix from CVS for transformations (#68964)- Add another bugfix for the postscript hinter- Add support for BlueFuzz private dict value, fixing rendering 
  glitch for Luxi Mono.- Add an experimental FT_Set_Hint_Flags() call- Update to 2.1.2
- Add a patch fixing freetype PS hinter bug- Added ft rpm build time conditionalizations upon user requests- Version 2.1.1- Add a fix for PCF character maps- automated rebuild- Updated freetype to version 2.1.0
- Added libtool fix for freetype 1.4 (#64631)- use "libtool install" instead of "install" to install some binaries (#62005)- Updated to freetype 2.0.9- Added proper docs+demos source for 2.0.8.- Added compat patch so 2.x works more like 1.x
- Rebuilt with new build toolchain- Updated to freetype 2.0.8, however docs and demos are stuck at 2.0.7
  on the freetype website.  Munged specfile to deal with the problem by using
  {oldversion} instead of version where appropriate.  <sigh>- bumping release so that we don't collide with another build of
  freetype, make sure to change the release requirement in the XFree86
  package- Made ttmkfdir inclusion conditional, and set up a define to include
  ttmkfdir in RHL 7.x builds, since ttmkfdir is now moving to the new
  XFree86-font-utils package.- Updated freetype to version 2.0.6- automated rebuild- Fix bug #56901 (ttmkfdir needed to list Unicode encoding when generating
  font list). (ttmkfdir-iso10646.patch)
- Use _smp_mflags macro everywhere relevant. (freetype-pre1.4-make.patch)
- Undo fix for #24253, assume compiler was fixed.- Fix build with gcc 3.1 (#56079)- Updated freetype to version 2.0.5- Added nkP&(-@(-)-F$?d	%	d	&:@HRR	4R

R R=rR
>RD RJRQTQ|RVVVWz(W8W9X:]FgTGgtRHlRIrRJsVXs\Ys`\sxR]xR^bdAeFfKkMlTtlRuRv!wRx@Ry{RAMA
RKgh Clibxml2-devel2.6.262.1.25.el5_11Libraries, includes, etc. to develop XML and HTML applicationsLibraries, include files, etc you can use to develop XML applications.
This library allows to manipulate XML files. It includes support
to read, modify and write XML and HTML files. There is DTDs support
this includes parsing and validation even with complex DtDs, either
at parse time or later once the document has been modified. The output
can be a simple SAX stream or and in-memory DOM like representations.
In this case one can use the built-in XPath and XPointer implementation
to select subnodes or ranges. A flexible Input/Output mechanism is
available, with existing HTTP and FTP modules and combined to an
URI library.Tn=builder17.centos.orgwCentOS-5CentOSMITDevelopment/Librarieshttp://xmlsoft.org/linuxx86_64#e<P
^'=.4
^
?
e_	65
s(w/SZ'	Of>2K
ShqfuP
OH)u{l2zsm~w7sp~c:c֛\^cR; Y,S'!ZC I$'2{}x@"+
	C^h>HA+y
[ rE7)%$%$PoCd-DG<.b~U%$u%fRr4u~\M=NIS7BTT1nt+KHOn^I-t6?{9uUrE$L
OBkVO	6vIia^Y\cXeeD.~l>Wp(G*	0^g#94#0<2NSCގ_`3M{%,aqTQoGcT;@`K_<-2FXC	4(CkkGZ8]dB4cm4OAA큤A큤A큤큤A큤A큤A큤A큤A큤,kp@






























































































































































"


































	

	
	
	



	
	
	
	


	





	


	

	
	

	

	
	
	



	




	

	
	



	
	



		

		














	j
R	@ is admin down (Herbert Xu ) [215887]
- x86_64: fix execshield randomization for heap (Brian Maly ) [214548]
- x86_64: check and enable NXbit support during resume (Vivek Goyal ) [215954]
- GPL export truncate_complete_page (Eric Sandeen ) [216545]
- mm: reject corrupt swapfiles earlier (Eric Sandeen ) [213118]
- QLogic qla2xxx - add missing PCI device IDs (Tom Coughlan ) [219350]
- mpt fusion bugfix and maintainability improvements (Tom Coughlan ) [213736]
- scsi: make fc transport removal of target configurable (Mike Christie ) [215797]
- gfs2: don't try to lockfs after shutdown (Steven Whitehouse ) [215962]
- xen: emulation for accesses faulting on a page boundary (Stephen C. Tweedie ) [219275]
- gfs2: dirent format compatible with gfs1 (Steven Whitehouse ) [219266]
- gfs2: Fix size caclulation passed to the allocator. (Russell Cattelan ) [218950]
- ia64: PAL_GET_PSTATE implementation (Prarit Bhargava ) [184896]
- CacheFiles: Handle ENOSPC on create/mkdir better (David Howells) [212844]
- connector: exessive unaligned access (Erik Jacobson ) [218882]
- revert: Audit: Add type for 3rd party, emit key for audit events (Eric Paris ) [217958]- touch softdog during oops (Dave Jones ) [218109]
- selinux: allow quoted commas for certain catagories in context mounts (Eric Paris ) [211857]
- xen: oprofile on Intel CORE (Glauber de Oliveira Costa ) [213964]
- Xen: make ballooning work right (xen part) (Rik van Riel ) [212069]
- Xen: make ballooning work right (Rik van Riel ) [212069]
- Xen: HVM crashes on IA32e SMP (Glauber de Oliveira Costa ) [214774]
- gfs2: Fix uninitialised variable (Steven Whitehouse ) [219212]
- GFS2: Don't flush everything on fdatasync (Steven Whitehouse ) [218770]
- Disable PCI mmconf and segmentation on HP xw9300/9400 (Bhavana Nagendra ) [219159]
- Audit: Add type for 3rd party, emit key for audit events (Eric Paris ) [217958]
- Fix time skew on Intel Core 2 processors (Prarit Bhargava ) [213050]
- Xen : Fix for SMP Xen guest slow boot issue on AMD systems (Bhavana Nagendra ) [213138]
- GFS2: fix mount failure (Josef Whiter ) [218327]
- cramfs: fix zlib_inflate oops with corrupted image (Eric Sandeen ) [214705]
- xen: Fix xen swiotlb for b44 module (xen part) (Stephen C. Tweedie ) [216472]
- xen: Fix xen swiotlb for b44 module (Stephen C. Tweedie ) [216472]
- scsi: fix stex_intr signature (Peter Zijlstra ) [219370]
- GFS2: Fix recursive locking in gfs2_permission (Steven Whitehouse ) [218478]
- GFS2: Fix recursive locking in gfs2_getattr (Steven Whitehouse ) [218479]
- cifs: Fix mount failure when domain not specified (Steve Dickson ) [218322]
- GFS2: Fix memory allocation in glock.c (Steven Whitehouse ) [204364]
- gfs2: Fix journal flush problem (Steven Whitehouse ) [203705]
- gfs2: Simplify glops functions (Steven Whitehouse ) [203705]
- gfs2: Fix incorrect fs sync behaviour (Steven Whitehouse ) [203705]
- fix check_partition routines to continue on errors (David Milburn ) [210234]
- fix rescan_partitions to return errors properly (David Milburn ) [210234]
- gfs2: Tidy up bmap & fix boundary bug (Steven Whitehouse ) [218780]
- Fix bmap to map extents properly (Steven Whitehouse ) [218780]
- ide-scsi/ide-cdrom module load race fix (Alan Cox ) [207248]
- dlm: fix receive_request lvb copying (David Teigland ) [214595]
- dlm: fix send_args lvb copying (David Teigland ) [214595]
- device-mapper mirroring - fix sync status change (Jonathan Brassow ) [217582]
- Xen: Copy shared data before verification (Herbert Xu ) [217992]
- s390: common i/o layer fixes (Jan Glauber ) [217799]
- Spurious interrups from ESB2 in native mode (Alan Cox ) [212060]- Xen: fix xen/ia64/vti panic when config sets maxmem (Aron Griffis ) [214161]
- Xen: ia64 making it work (Aron Griffis ) [210637]
- Xen: upstream patches to make Windows Vista work (Steven Rostedt) [214780]
- enable PCI express hotplug driver (Kei Tokunaga ) [207203]
- d80211: kABI pre-compatibility (John W. Linville ) [214982]
- Xen: ia64 kernel unaligned access (Aron Griffis ) [212505]
- Xen: getting ia64 working; kernel part (Aron Griffk
-@---redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Than Ngo <than@redhat.de>Florian La Roche <Florian.LaRoche@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Bernhard Rosenkränzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Backported SSL options configuration
  Resolves: rhbz#1157811- fix MAXHOSTNAMELEN for FQDN
  Resolves: rhbz#640232- rpm attributes S,5,T not recorded for statistics file- fix specfile for passing rpm -V test (#555277)- fix verification of SSL certificate with NUL in name (#553618, CVE-2009-4565)
- do not accept localhost.localdomain as valid address from smtp (#449391)
- skip colon separator when parsing service name in ServiceSwitchFile (#512871)
- exit with non-zero error code when free space is low (#299951)
- fix -qG description in man page (#250552)
- fix comments in sendmail.mc to use correct certs path (#244012)
- add MTA to provides (#494408)
- fix %dist macro use (#440616)
- compile with -fno-strict-aliasing
- skip t-sem test as it doesn't allow parallel testing- added missing LDAP_DEPRECATED flag
  Resolves: rhbz#217533- unify sendmail.mc
- remove version information from sendmail helpfile- new version 8.13.8 fixes CVE-2006-4434 (denial of service via a long header
  line)- dropped chown of /etc/mail/authinfo.db (#199455)- using new syntax for access database (#177566)
- fixed failure message while shutting down sm-client (#119429)
  resolution: stop sm-client before sendmail
- fixed method to specify persistent queue runners (#126760)
- removed patch backup files from sendmail-cf treek0=,@,,,tion files
- files.c: fix a heap corruption bug in lock/unlock (#51750)
- files.c: close a memory leak in reading of files- files.c: remove implementation limits on lengths of lines- lusermod: change user name in groups the user is a member of during renames
- lgroupmod: change primary GID for users who are in the group during renumbers
- ldap.c: handle new attributes more gracefully if possible
- add ru translation files- rename the quota source files to match the library, which clears up a
  file conflict with older quota packages
- add ja translation files- add lu_ent_clear_all() function- close up some memory leaks
- add the ability to include resident versions of modules in the library- fix incorrect Py_BuildValue invocation in python module- stop leaking descriptors in the files module
- speed up user creation by reordering some checks for IDs being in use
- update the shadowLastChanged attribute when we set a password
- adjust usage of getXXXXX_r where needed
- fix assorted bugs in python binding which break prompting- install sv translation
- make lpasswd prompt for passwords when none are given on the command line
- make sure all user-visible strings are marked for translation
- clean up some user-visible strings
- require PAM authentication in lchsh, lchfn, and lpasswd for non-networked modules- print uids and gids of users and names in lid app
- fix tree traversal in users_enumerate_by_group and groups_enumerate_by_users
- implement enumerate_by_group and enumerate_by_user in ldap module
- fix id-based lookups in the ldap module
- implement islocked() method in ldap module
- implement setpass() method in ldap module
- add lchfn and lchsh apps
- add %d substitution to libuser.conf- finish adding a sasldb module which manipulates a sasldb file
- add users_enumerate_by_group and groups_enumerate_by_users- luserdel: remove the user's primary group if it has the same name as
  the user and has no members configured (-G disables)
- fixup some configure stuff to make libuser.conf get generated correctly
  even when execprefix isn't specified- only call the auth module when setting passwords (oops)
- use GTrees instead of GHashTables for most internal tables
- files: complain properly about unset attributes
- files: group passwords are single-valued, not multiple-valued
- add lpasswd app, make sure all apps start up popt with the right names- actually make the new optional arguments optional
- fix lu_error_new() to actually report errors right
- fix part of the python bindings
- include tools in the binary package again
- fixup modules so that password-changing works right again
- add a "key" field to prompt structures for use by apps which like to
  cache these things
- add an optional "mvhomedir" argument to userModify (python)- finish home directory population
- implement home directory moving
- change entity get semantics in the python bindings to allow default values for .get()
- add lu_ent_has(), and a python has_key() method to Entity types
- don't include tools in the binary package
- add translated strings- lib/user.c: catch and ignore errors when running stacks
- lusermod: fix slightly bogus help messages
- luseradd: when adding a user and group, use the gid of the group
  instead of the user's uid as the primary group
- properly set the password field in user accounts created using
  auth-only auth modules (shadow needs "x" instead of "!!")
- implement home directory removal, start on population- fix group password setting in the files module
- setpass affects both auth and info, so run both stacks- make the testbed apps noinst- fix errors due to uninitialized fields in the python bindings
- add kwargs support to all python wrappers
- add a mechanism for passing arguments to python callbacks- stub out the krb5 and ldap modules so that they'll at least compile again- don't bail when writing empty fields to colon-delimited files
- use permissions of the original file when making backup files instead of 0600- finish implementing is_locked methods in files/shadow mj'@ don't accept replies to old recovery messages (David Teigland ) [215430]
- x86_64: kdump mptable reservation fix  (Vivek Goyal ) [215417]
- Add Raritan KVM USB dongle to the USB HID blacklist (John Feeney ) [211446]
- Fix bogus warning in [un]lock_cpu_hotplug (Prarit Bhargava ) [211301]
- Xen: Avoid touching the watchdog when gone for too long (Glauber de Oliveira Costa ) [216467]
- add missing ctcmpc Makefile target (Jan Glauber ) [184608]
- remove microcode size check for i386 (Geoff Gustafson ) [214798]- add the latest 2.6.18.4 security patches (Don Zickus) [217904]
- revert: mspec failures due to memory.c bad pte problem (Erik Jacobson ) [211854]- disable W1 config (Dave Jones ) [216176]
- Xen netback: Reenable TX queueing and drop pkts after timeout (Herbert Xu ) [216441]
- Xen: fix profiling (Rik van Riel ) [214886]
- bnx2: update firmware to correct rx problem in promisc mode (Neil Horman ) [204534]
- sound-hda: fix typo in patch_realtek.c (John W. Linville) [210691]
- Fix sys_move_pages when a NULL node list is passed. (Dave Jones ) [214295]
- proc: readdir race fix (Nobuhiro Tachino ) [211682]
- device mapper: /sys/block/dm-* entries remain after removal (Milan Broz ) [214905]
- Fix 64k page table problems on ppc specific ehca driver (Doug Ledford ) [199765]
- configfs: mutex_lock_nested() fix (Eric Sandeen ) [211506]
- CIFS: Explicitly set stat->blksize (Eric Sandeen ) [214607]
- Compute checksum properly in netpoll_send_udp (Chris Lalancette ) [214542]
- Noisy stack trace by memory hotplug on memory busy system (Kei Tokunaga ) [213066]
- catch blocks beyond pagecache limit in __getblk_slow (Eric Sandeen ) [214419]
- xen privcmd: Range-check hypercall index. (Herbert Xu ) [213178]
- strange messages around booting and acpi-memory-hotplug (Kei Tokunaga) [212231]
- Fix panic in CPU hotplug on ia64 (Prarit Bhargava ) [213455]
- Fix spinlock bad magic when removing xennet device (Chris Lalancette ) [211684]
- netlabel: various error checking cleanups (Eric Paris ) [210425]
- mspec failures due to memory.c bad pte problem (Erik Jacobson ) [211854]
- Fix autofs creating bad dentries in NFS mount (David Howells ) [216178]- Set HZ to 1000 for kernel and 250 for Xen (Don Zickus) [198594] 
- Custom Diagnostics kernel module fails to load on RHEL5 (Janice Girouard) [213020] 
- kernel: FS-Cache: error from cache: -105 (2nd part) (Don Zickus) [214678]- configure XPC as a loadable kernel module instead of static (Erik Jacobson) [213903] 
- kernel BUG at drivers/xen/core/evtchn.c:482! (Glauber de Oliveira Costa) [210672] 
- IPv6 MRT: 'lockdep' annotation is missing? (Thomas Graf) [209313] 
- sort PCI device list breadth-first (John Feeney) [209484] 
- reenable xen pae >4GB patch (Don Zickus)- disable the xen-pae patch due to compile problems- Kernel Panic on Initial boot of guest (Steven Rostedt) [211633] 
- kernel unable to read partition (device busy) (Peter Zijlstra) [212191] 
- QEMU always crashes (Don Zickus) [212625] 
- kernel: FS-Cache: error from cache: -105 (Steve Dickson) [212831] 
- DLM oops in kref_put when umounting (Patrick Caulfield) [213005] 
- gfs umount hung, message size too big (Patrick Caulfield) [213289] 
- CPU hotplug doesn't work trying to BSP offline (Keiichiro Tokunaga) [213324] 
- status messages ping-pong between unmounted nodes (Dave Teigland) [213682] 
- res_recover_locks_count not reset when recover_locks is aborted (Dave Teigland) [213684] 
- disable CONFIG_ISA (Don Zickus)- Remove support for ipw3945 driver (Don Zickus) [195534] 
- acpiphp will not load due to unknown symbols (Prarit Bhargava) [209506] 
- Can not install rhel5 b1 on ipr dasd. (Janice Girouard) [210851] 
- Can't make SCTP connections between Xen guests (Don Zickus) [212550] 
- eHEA update to support 64K pages for Power6 (Janice Girouard) [212041] 
- Failure to boot second kernel on HP hardware (Don Zickus) [212578] 
- dlm deadlock during simultaneous mount attempts (Dave Teigland) [211914] 
- CMT-eligible ipw2200/2915 driver (John W. Linville) [184862] 
- CVE-2006-5174 copy_from_user informatiojk2@@@A?CWI*rI:?UGV(fn_!..yr[&
6ADM?LP˚@?UGV(Ȋd&(`s
۶Y˺{X}HtNG440b0cb0e887724bec936bb16c3f78596ecd9413\<;%\<ild- patch PAM configuration to use relative path names for the modules, allowing
  us to not worry about which arch the modules are built for on multilib systems- update to 3.5p1, merging in filelist/perm changes from the upstream spec- merge- fix to build on multilib systems- added gssapi patches and uncommented patch here- pull patch from CVS to fix too-early free in ssh-keysign (#70009)- 3.4p1
- drop anon mmap patch- rework the close-on-exit docs
- include configuration file man pages
- make use of nologin as the privsep shell optional- update to 3.3p1
- merge in spec file changes from upstream (remove setuid from ssh, ssh-keysign)
- disable gtk2 askpass
- require pam-devel by filename rather than by package for erratum
- include patch from Solar Designer to work around anonymous mmap failures- automated rebuild- don't require autoconf any more- build gnome-ssh-askpass with gtk2- update to 3.2.3p1
- merge in spec file changes from upstream- update to 3.2.2p1- drop buildreq on db1-devel
- require pam-devel by package name
- require autoconf instead of autoconf253 again- pull patch from CVS to avoid printing error messages when some of the
  default keys aren't available when running ssh-add
- refresh to current revisions of Simon's patches- reintroduce Simon's gssapi patches
- add buildprereq for autoconf253, which is needed to regenerate configure
  after applying the gssapi patches
- refresh to the latest version of Markus's patch to build properly with
  older versions of OpenSSL- bump and grind (through the build system)- require sharutils for building (mindrot #137)
- require db1-devel only when building for 6.x (#55105), which probably won't
  work anyway (3.1 requires OpenSSL 0.9.6 to build), but what the heck
- require pam-devel by file (not by package name) again
- add Markus's patch to compile with OpenSSL 0.9.5a (from
  http://bugzilla.mindrot.org/show_bug.cgi?id=141) and apply it if we're
  building for 6.x- update to 3.1p1- update to SNAP-20020305
- drop debug patch, fixed upstream- update to SNAP-20020220 for testing purposes (you've been warned, if there's
  anything to be warned about, gss patches won't apply, I don't mind)- add patches from Simon Wilkinson and Nicolas Williams for GSSAPI key
  exchange, authentication, and named key support- remove dependency on db1-devel, which has just been swallowed up whole
  by gnome-libs-devel- adjust build dependencies so that build6x actually works right (fix
  from Hugo van der Kooij)- update to 3.0.2p1- update to 3.0.1p1- update to current CVS (not for use in distribution)- merge some of Damien Miller <djm@mindrot.org> changes from the upstream
  3.0p1 spec file and init script- update to 3.0p1
- update to x11-ssh-askpass 1.2.4.1
- change build dependency on a file from pgk0C@CsBIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnu	




























Zk'@8f593ad1afe24828a76d5041ba083ceb56965a8a9f5dc4bcd186f08cf0ce4892ab194506bbd033fe025242f3ec88d6dbd93a7e1d88b372b6825bb1333b06746e003b0a66e849f1f094229f8fb3917b8a0507589cac6c16fe2983ebb802c80a7e261ac03b792d9e9202e0dcd0a6c3e205fa6186a65fb3b270c8dfbb7a701587cf2fac226ac06f3b32ca9d7830ab1c019a7dba2f24e25fa030bf0e83a35ea19a1aa269a3f6ea012e3d035e10087d9f31418e1009f23b85e3055317bc2204746b9f8dad7e20a0b660d39d464d7a2b4bd0ad0837b19f5b8645540a849c9c5451bf295f725830d9e2a90dc2bbcce64714dacaad0fb8699ba92a3b8789088b77f15b26141ba0a35f6e6ccc85bcc568c1aadd8b37c8d5821c27519d9fc66aee279f7309c9620dc9a637fa5aa3590af042ecec6f3bb70c8f0953914e2996fddd60b9e1e5595e35d1e84d8fbfed76b047bdd5d4d4cc1f1a095ef78455e9729686435f06885548d977e2f30c23aea11874a619f70d9ab5bcc43929ebea1751761361dee91ed24a76d0833f67b77b2831732e148b0e80a7258a59c7e29242d93a1ac334c00ecff557565829a509d46f9f7d69151982e50f6a9aff72ff6cd2f714179a1012f88a72ab1894353c9613221cbaafca086391bda3802d1e60c0e1ef8b24387a5d02a74c6cb9e41d04b679f362df4792a65ca40c1a34c475144edb018f9727fe8bb5376a4b93a7f88fa79d04849cef7263cc86c6f963bc54a98170565b4066af28e70b0015b0ffea1db1c53fd6d25d8320c937c75ceb567a59d5ff6fc424c806483575afdaba65c8bd56f20b5bcd9516cc6b9df6e64df6bf0fbfa10833c33eea4f9a746f0ad6dcc59e1cb62f97b91d617e38239133a9a3cb6f76cf1ff85f54135212b36707fbbdea26400c105b7b0d7c7d787af1f0d14227821d20a8b780e5aed27dc504394abab9c5c173a12638e083c569ef86c4b5d9ea40e249cda2e7ac2383fcbd8703d8e532d6342c7dae3c3eae2b60e4c10927ab8e6bedc219760e0789a855317415bae790c190f4c89396d9670021306de6788759d6850e4fbc2e1147ab771b19c31dd6a2ed013980a982f318feb27d3a3b2da1fb9ae0cdb35e95de35a7ec5b14d8930952e92fe6b840598cf654419c3caa3922d02bd3df7ce2bf53e42808fa80bb3b798384ca65bda802bf6cee8e8ce09fda116463073280e54c18670f9621108a0317c97b71e569344290cbe08965e945d9d6b14dfb0132777186c7e7c72269eae005b985786cc4570fa94dfa5e30325e923b7031783f41323b835f9da4a9d31bec141b594d80c26cd1b74feb733d98dc85a6542105afcf0fa70e5b5b28e6bec85ca50eef95b038e0ad3ca1e6f24f646c50925c8ce1ea47320b0c606cdd87304a2070394777d0dde6b2bccc4708203c1a165f7166f96f6e6f02015ef4ece419becd159578540ee40475aea8e83cf0b6207204457edd57b1034068d1f292b492edf3d7151bbd65f72ba12a44b2de540c2d6898c05d72323a111ef4e491ec6a43c35ba0c2bae71b58f7074f65b2af4955743f1fbe30ed2f4d85dbdfacef8d05b226a84b29576517a1a2ab763b1a4d5ee9f62cfa22e7f5aedec9346b0c7a78ee28068423f350ef8bc1fa73c2fc215af724b6379817c0e422ba7202a300f8c40a5d62c325c86d5497b7fd49c1e54e9fe21dba04aae0bcccf25a2f622226a1d0fed50b22ef6f0c5f97b412f67d812af01205528f597cacd052b78f00553fa933fa05adae1970a38adafff6c3f3b54fa7f26418a86f0064c3ee3eb59348e41f83a889011210fa4074cd1a1d339b000b2a4ce9c8abafe7aa9e6c6c68eaf0db2b7adf99911026ec9f3445605f8a7d6c040a044bcb19bab923bed9ae923563cad3e10b59b35fc7c4e689e46aa446a9b69953d04c95ae2ba7395720af88b846432839f5d45663970249d6fd018957f0faade8bd5c2f611a11c77278527485cbed262c09c199a97ecda1b84f64bb8b7d40f273e2bfe12274a2df1c2599a191b2f2e4ba0b4d4bd553a44b30fd3c5fe492ce31cdbacbed18719d376390ff84dd905bceec31c9a37c4c8a077d38a96bbcddfdfc5c701f7bd114d07a228340283f083cbd16d1bd33bbbb529d49a23f570a7da8b6d7cad760851570d2ad3655271d574ddf355b240a54ae2320ccf8039b8de5f0bbcaf967d0482ab3b0d4a9492a47d1438c362aaa4f900b7d68f3dd5e67d57e8cce46daa49d35de943d70162fb630bf094a02d86cfe35a06d3b58646e1151cf852e48e73feab0596cf84d04e887f21b0a58bf52729080401d329d56fee146d43d1b505c86e72f8a67abc091bde8de6063d7df0630cfe383ecb66c241a06548bb98ab844e7670ebb405d99dfc5104df132a2005ed11d39bcd79a26b8269678c0ebd5f9c9204706ba3237334f51c5c468343bbd34b235c363a58bbd8516824cb481bc2e2449d979392ed0a63783e6c152bb02e88bc77fc957e84f7ceb9180506af40cbefed7f52356e96c617bbace44cd61617425e6f2b61abd86351e6d4f18ce44f43fa9b937943a3bafb3912c9c330e76ab54438aec1e81ca530d03d6c412deee788e13e631a2912d68cb65a7d3d9fb7eb51e87ebb708c19b1994a2315bb70ce5d0e7d0b2220444a9aea85401d242b7876189883fd23b1106c90acb4d98129074539d1ebeda0e48d597ddad094a58e197fb8a333f6b798398f8c9b9ccea066c5ccc5035d70e636425b027a7943c36b589da65cc60cd9d2d2b1ed24d9583f11e89779e36f9bd8ae61Lkȣ
@S HEAD.
- Added xorg-x11-server-1.0.1-SEGV-on-null-interface.patch which prevents a
  SEGV on null interfaces (#174279,178986)- Updated to xserver 1.0.1 from X11R7.0- Added "Provides: libxf86config-devel = %{version}-%{release}" to sdk package.- Added xserver-1.0.0-parser-add-missing-headers-to-sdk.patch to provide the
  necessary libxf86config.a headers to be able to use the library. (#173084)- Updated to xserver 1.0.0 from X11R7 RC4
- Removed the following patches, which are now integrated upstream:
  - xorg-server-0.99.3-rgb.txt-dix-config-fix.patch,
  - xorg-server-0.99.3-fbmmx-fix-for-non-SSE-cpu.patch
- Changed manNx directories to manN to match upstream defaults.
- Added libxf86config.a to sdk subpackage.
- Updated build dependency of "mesa-libGL-devel >= 6.4.1-1"
- Added "BuildRequires: xorg-x11-font-utils >= 1.0.0-1" to be able to query
  the fontdir from fontutil.pc which is implemented currently by a custom
  patch.
- Enable xtrap, xcsecurity, xevie, and lbx on all builds, not just DRI builds.
- Fix sdk installation path, so that drivers can find the files again.
- Update file manifest, to deal with X server modules that have moved to
  a subdir, etc.- Add a few missing BuildRequires.- Added "Requires: xorg-x11-drivers >= 0.99.2-4" as a dependency of the Xorg
  subpackage, to ensure that anaconda installs all of the drivers during OS
  installs and upgrades, as requested by Jeremy Katz.- Added xorg-server-0.99.3-rgb.txt-dix-config-fix.patch which fixes the
  --with-rgb-path option to actually *work*.
- Updated libdrm dep to 1.0.5- Update xorg-x11-server-utils dep to 0.99.2-5 to ensure rgb.txt is installed
  in correct location - _datadir/X11/rgb
- Added --with-rgb-path configure option to specify _datadir/X11/rgb so the
  X server finds the rgb.txt database properly, for bugs (#173453, 173435,
  173428, 173483, 173734, 173737, 173594)
- Added xorg-server-0.99.3-fbmmx-fix-for-non-SSE-cpu.patch to prevent SSE/MMX
  code from being activated on non-capable VIA CPU. (#173384,fdo#5093)- Add the missing rpm pre script from monolithic xorg-x11 packaging,
  clean it up a bit, reorder it for slight performance gain.
- Add some perl magic to pre script to remove RgbPath from xorg.conf,
  in order to fix bug (#173036, 173435, 173453, 173428)
- Add more perl magic to pre script to update ModulePath to the new
  location if it is specified in xorg.conf.
- Added xorg-x11-server-0.99.3-init-origins-fix.patch ported from monolithic
  xorg-x11 package to fix Xinerama bug.
- Added xorg-redhat-die-ugly-pattern-die-die-die.patch to kill the ugly grey
  stipple once again for bug (#173423).
- Added "BuildRequires: libdrm-devel" for DRI enabled builds.- Xorg server should be suid for users to be able to run startx (#173064)- Added temporary "BuildRequires: libXfont-devel >= 0.99.2-3" and
  "Requires: libXfont-devel >= 0.99.2-3" to ensure early-testers of
  pre-rawhide modular X have installed the work around for (#172997).
- Added implementation specific "Requires: xkbdata" to Xorg subpackage, as
  we want to ensure the xkb data files are present, but allow us the option
  of easily switching implementations to "xkeyboard-config" at a future
  date, if we decide to go that route.
- Re-enable _smp_mflags during build.
- Added "Requires: xorg-x11-drv-vesa" to Xorg subpackage (#173060)- provide Xserver
- add another requires for basic bits- add some deps to the Xorg subpackage for base fonts, keyboard and mouse 
  drivers, and rgb.txt that the server really wont work without- Update to xorg-server-0.99.3 from X11R7 RC2.
- Add xorg-server.m4 to sdk subpackage, and "X" symlink to Xorg subpackage.- Added "Requires: xkbcomp" for Xorg server, as it invokes it internally.- Added "BuildRequires: libXtst-devel" for Xtst examples.- Added versioning to Xorg virtual Provide, to allow config tools and driver
  packages to have version based requires.- Update to xorg-server-0.99.2 from X11R7 RC1.
- Add "BuildRequires: xorg-x11-util-macros >= 0.99.1".
- Add "BuildRequires: mesa-source >= 6.4-4" for DRI bulu
.@...447c0858f73efd96e388b62d682d3e837a3f4ddc94928e7fd0f356e2a756a41c9656eaf3a0a009754de7f074e307b19dd081080b6a1f3394bc6b886f8b75a3ebe2ab5bcd2544c18b8f3410777ff0f76f0a29c29d7210d1de8cae9ec4d2ffdc17fa8f919a9d0b0a417e20d95c0a61be43dbba158c1fd8a66539fbfdf8b06f0169f74f2d879c84bed574e142b7e375e2bb5b8225694f0f3a89e8d31d85ae76799bf1ad565c49089ff2328315534e0127c0c14dcb94b3bc538000dabbcc7fd73d1070a98acb413df3a042693a09e0c4d04ce41a5d2eaf1d3a37d15716a67eb4a2a8841c1bb0993984eb018adab9a7b3ac70a980bf7e91a698337dd49ef2a90255b785d2fda36c22f67772e64ee0472700a7905493967cb4dabfd71ed16d11389149f2067e2dfb70fca01d788af8c4368c8ae60b4e46b52c8078c17be75f2dbfbee20d870728c5a467d56c19020e479c3a71abab3cf56f48fa73f18743a7ea23ffbd368e164889a0e766a753d6ef806ef074dc20f271e914b49d7e6148c982d9959b74cc512c6a47483b65dac457ffad7fb3330d601b4a9848d192d654cf620c95e6f7f05b78b7dd36156b3982e02b20834bb76d10c1454558983fd320e33a3bb8aa9f66a57d51dc9cb595140e074032538d02105684976eef54a1ccea1092925ddcad835ce2d1bb15f0ff7d324bc8938b8d3f0d81c742f0a458a8971e01547733b69d98d433f77ed76cff002330af0eafacef3941ed5d4d4ac991c7f38bd3b90eae68aaca79df6f9cbed7c62f278a6d0a565f10bef55b188274d81aaf4b948ac85c5efe9547fcdf67f5da6708ff2d8b8b02375b5e28e28be3a22f7ec06853221c9f5f9a884133ed3fa358ae30469e676276a50209fabe341110e9ece74455a0792d9401ef57d99f8bc60d5deba49eac59fd01d5291c280a5733dfba8d28153bb83b06d8f7fd3557c391d8132af5b5444828fc3a832dabf7e7e88c06306e3e3f1eff62efbe23ca741d4850c8bfe55864309a8d5ffb8bfb521874027b964b5e626e98a5cf8423324d4972bff902c3f55e306cbde1c5365d5a5192a1884e03bd25abef553da2bc9aef8f8825d65f34610adc7cc4e53f958767fd69fdae25f2d3c76448851e45dca2a65a77f64f738bbf8d20c6146aef92f25947593f029674b02db19f7bc8ae7c08da82072d4d70e2571c856c3e97ea97bf0af3dcdc7f776afdb43168b329da9893e34099c7d8ad5cb9c940e29e0aa1e1caa825e50231941b4a5168rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrok`y
X@XYWepend on main libs- Update --trusted stubs for rpmk breakage- Add --trusted stubs from upstream- Resurrect doxygen (#187714)- remove redundant elfutils-libelf buildrequires
- rpm-python doesn't require elfutils (related to #188495)- Skipdirs on erase again (#187308)
- Make fcntl lock sensitive to --root (#151255)
- Fix netshared path comparison (#52725)
- Fix rpm vercmp (#178798)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Rebuild for newer neon
- Fix scriptlet deadlock (#146549)- Don't emit perl(main) (#177960)- Don't mmap large files- Add mono req/provides support- Remove rpm .la files (#174261)
- Cron job use paths (#174211)- Ignore excluded size (#89661)- Don't skipDirs on erasures (#140055)- Add elfutils Build Requires to rpmbuild (#155129)
- Don't do conflicts if both files %ghost(#155256)
- Fix popt charset for various languages (#172155)
- Don't include .la file (#174261)- rebuilt with new openssl- rebuild for sqlite changes- Actually fix context verification where matchpathcon fails (#162037)- Fix build with CFLAGS having --param
- Fix for context verification in /tmp (#162037)- popt minor version requires- popt minor version bump
- revert to perl.req/perl.prov for now- Upgrade to upstream release- Update translations (#154623)- Drop signature patch
- dangling unpackaged symlinks- Check for symlinks in check-files (#108778)
- Move zh_CN (#154623)
- Test fix for signing old rpms (#127113)- Fix typo
- Fix typo- Add missing fsm.c from matchpathcon patches- Fix typo- Yet more matchpathcon- Some more matchpathcon work- matchpathcon fixup- Use matchpathcon (#151870)- Remove $RPM_BUILD_ROOT and $RPM_BUILD_DIR from distribued .la files (#116891)
- Don't ship static version of _rpmdb.so
- BuildRequires: readline-devel- Fix for (pre,postun) (#155700)
- Erase ordering- add patch to fix segfault with non-merged hdlists- enabled prereqs again- Add devel requires libselinux-devel
- Fileconflicts as FC3 (#151609)- rebuild against renamed sqlite package (#149719).- fix build with new glibc- disable hkp by default- fix build with gcc 4- fix posttrans callback check being backwards (#149524)- don't classify files in /dev (#146623).
- don't build with sqlite3 if <sqlite3.h> is missing.- zlib: uniqify certain symbols to prevent name space pollution.
- macosx: include <sys/types.h> so that python sees the u_char typedef.
- macosx: change to --prefix=/usr rather than /opt/local.
- use waitpid rather than SIGCHLD reaper.
- rip out DB_PRIVATE revert if not NPTL, it's not the right thing to do.- permit build scriptlet interpreters to be individually overridden.- perform callbacks as always (#147537).- fix: length of gpg V4 hash seed was incorrect (#146896).
- add support for V4 rfc-2440 signatures.- add sqlite internal (build still expects external sqlite3-3.0.8).
- sqlite: revert to original narrow scoping of cOpen/cClose.- python: force dbMatch() h# key to be 32 bit integer (#146477).- more macosx fiddles.
- move global /var/lock/rpm/transaction to dbpath.
- permit fcntl path to be configured through rpmlock_path macro.
- add missing #if defined(ENABLE_NLS) (#146184).- changes to build on Mac OS X using darwinports neon/beecrypt.
- add https://svn.uhulinux.hu/packages/dev/zlib/patches/02-rsync.patch- build against external/internal neon.- mac os x patches (#131943,#131944,#132924,#132926).
- mac os x patches (#133611, #133612, #134637).- upgrade to db-4.3.27.
- revert MAGIC_COMPRESS, real fix is in libmagic (#143782).
- upgrade to file-4.12 internal.- use package color as Obsoletes: color.- automagically detect and emit "python(abi) = 2.4" dependencies.
- popt 1.10.1 to preserve newer.- force *.py->*.pyo byte code compilation with brp-python-bytecompile.builder17.centos.org 1418155176CC9C!C C767877796CCCCCk>,@,,(edhat-linux-gnu	ASCII C program textASCII English textASCII textBourne shell script text executableXML document textcurrent ar archivedirectorysymbolic link to `libexslt.so.0.8.13'symbolic link to `libxslt.so.1.1.17'RRR?P͇$S<`?PRGV(ȻR;]	u59$
Y?PRGV(utwseVo-śӐ`\hl$741cbce8d8629e9484496a100a328f9379cb895c\="h/usr\<ć)H((cdB
P3KD;_
y0m."݇bWy,{E&ybHاǚPxxxmNII5T}'w#Ds4V4 r<q)1
ޘK$a[&J`:{6`#`sQePHYUNCnKe>Y{^A1k9睖s&G99;esNvoI$Eo@UN.Q8@GDCϱKO.B	$.9gYHT8զoF.[=4+3:׆
,JlO()(*͙C
K]\R(/\%HB'BVppFx\ξ<1NB)~K37%x1nC^6ϡ*xW6Oq.v꘍+Խ~J%J3!+*,ylk{!SC/lib64/security/pam_krb5/%l/usr/include/PCSC/assv/usr/include/GL/internal/v/usr/include/GL/n
7:P "#$%&+,-.SSSSSS
C/lib64/security/pam_krb5/%l/usr/include/PCSC/assv/usr/include/GL/internal/v/usr/include/GL/n
/usr/include/	/usr/bin/a/usr/X11R6/bin///usr/X11R6/ZAhciq-C/usr/h%a
1?CERUX]u	 !(;<>Z[^bj	"+>^//sbin/inu3)l/root/.1./mnt/?/lib64/security/pam_filter/u	l.@....mc
- remove version information from sendmail helpfile- new version 8.13.8 fixes CVE-2006-4434 (denial of service via a long header
  line)- dropped chown of /etc/mail/authinfo.db (#199455)- using new syntax for access database (#177566)
- fixed failure message while shutting down sm-client (#119429)
  resolution: stop sm-client before sendmail
- fixed method to specify persistent queue runners (#126760)
- removed patch backup files from sendmail-cf tree (#152955)
- fixed missing dnl on SMART_HOST define (#166680)
- fixed wrong location of aliases and aliases.db file in aliases man page
  (#166744)
- enabled CipherList config option for sendmail (#172352)
- added user chowns for /etc/mail/authinfo.db and move check for cf files
  (#184341)
- fixed Makefile of vacation (#191396)
  vacation is not included in this sendmail package
- /var/log/mail now belongs to sendmail (#192850)- rebuild- dropped reference to Red Hat Linux in sendmail-redhat.mc (#176679)- new version 8.13.7 (#195282)
- fixes CVE-2006-1173 (VU#146718): possible denial of service issue caused by
  malformed multipart messages (#195776)- new version 8.13.6 (fixes VU#834865)
- dropped libmilter-sigwait patch (fixed in 8.13.6)- fixed selinuxenabled path in initscript
- fixed error handling with sigwait (#137709)
  Thanks to Jonathan Kamens for the patch
- fixed prereq for cyrus-sasl: now using /usr/sbin/saslauthd
- appended 'dnl' to cert tags in sendmail.mc- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- rebuilt against new openssl- use include instead of pam_stack in pam config- new version 8.13.5
- fixed email address in changelog- using new certificates directory /etc/pki/tls/certs- added configuration example for Cyrus-IMAPd to sendmail.mc (#142001)
  Thanks to Alexander Dalloz- new version 8.13.4
- added requires for the sendmail base package in sendmail-cf, sendmail-devel
  and sendmail-doc
- dropped upstream close_wait.p2 patch- dropped direct support for bind: no bind in confLIBSEARCH anymore,
  using libresolv again- fix libbind include path - use /usr/include/bind/netdb.h, no
- /usr/include/netdb.h - bug: 150339- fixed gcc4 build: use double quotes for confOPTIMIZE to avoid m4 confusion
  with ','
- fix for ppc: using tripple-quotes- new version 8.13.3 with closewait.p2 patch- new version 8.13.2
- thanks to Robert Scheck for adapting the patches- rebuild against db-4.3.21.- added missing BuildRequires for groff (#134778)
- added socketmap support (#131906)- applied Sendmail Errata (2004-08-24): errata_cataddr (#131179)- new version 1.13.1- fixed init script to not complain missing sendmail-cf package (#126975)
- better message in /etc/mail/Makefile for missing sendmail-cf package.- new version 8.13.0
- made /etc/mail/Makefile complain missing sendmail-cf package (#123348)
- fixed ownership of %{_includedir}/libmilter (#73977)
- moved back to /usr/share/ssl/certs as certificate directory (see sendmail.mc)
- extended sendmail.mc for spam protection- rebuilt- Fix selinuxenabled location- Fix security context of pid file for selinux- fixed alternatives slave for sendmail.sendmail- set path to cyrus-imapd deliver- fixed spec file- added authinfo to possible sendmail maps: /etc/mail/Makefile (#119010)
- fixed minor version in changelog- new slave in alternatives for sendmail man page- rebuilt- removed buildreq for gdbm-devel- RH3.0E version: sasl1, no pie, old_setup (provide /etc/aliases)
- new switches for pie and old_setup- new Sendmail.conf for sasl1 (#114726)- added information for saslauthd and AUTH (#113463)
- fixed STATUS_FILE in sendmail-redhat.mc (#114302)
- reset mta after update if mta was sendmail (#114257)
- enabled pie for ia64 again- removed /etc/aliases (now in setup)- /usr/lib/sendmail is in alternatives, now
- removed trailing / from stdir
- fixed define for STATUS_FILE- disabled pie for ia64- new version 8.12.11
- pie- fc2 version (with sasl2)- reverted to sasl1 for 3.0E: added with_sasl1
- spec file cleanup
-k@
,@,,,orrectly when we encounter failures initializing
- don't double-close modules which fail initialization
- ldap: don't set an error in cases where one is already set- use a crypt salt consistent with the defaults/crypt_style setting when
  setting new passwords (#79337)- rebuild- expose lu_get_first_unused_id() as a package-private function
- provide libuser.ADMIN.getFirstUnusedUid and libuser.ADMIN.getFirstUnusedGid
  in python- fix not freeing resources properly in files.c(generic_is_locked), spotted by
  Zou Pengcheng- degrade gracefully
- build with --with-pic and -fPIC
- remove unpackaged man page- translation updates- doc updates -- cvs tree moved
- language updates
- disallow weird characters in account names- automated rebuild- files: ignore blank lines in files
- libuser: disallow creation of accounts with names containing whitespace,
  control characters, or non-ASCII characters- refresh translations
- fix a heap-corruption bug in the python bindings- bump version
- refresh translations- ldap: cache an entity's dn in the entity structure to try to speed things up- rebuild in new environment- add missing buildreqs on cyrus-sasl-devel and openldap-devel (#59456)
- translation refresh- fix python bindings of enumerateFull functions
- adjust prompter wrapping to not error out on successful returns- be more careful about printing error messages
- fix refreshing after adding of accounts
- ldap: try to use a search to convert names to DNs, and only fall back to
  guessing if it turns up nothing
- files: fix an off-by-one in removal of entries- refresh translations
- fix admin() constructor comments in the python module- automatically refresh entities after add, modify, setpass, removepass,
  lock, and unlock operations
- remove debug spewage when creating and removing mail spools
- files: fix saving of multi-valued attributes
- rename MEMBERUID attribute for groups to MEMBERNAME- files: fix bug in removals
- ldap: revert attempts at being smart at startup time, because it makes UIs
  very messy (up the three whole dialogs just to start the ldap stuff!)- fix thinko in dispatch routines- lgroupmod: fix thinko- rebuild in new environment- move shadow initialization for groups to the proper callback
- rework locking in the files module to not require that files be writable- expose lu_strerror()
- add various typedefs for types used by the library- add removepass() functions- lchfn,lchsh,lpasswd - reorder PAM authentication calls
- include API docs in the package- ldap: finish port to new API
- sasl: finish port to new API (needs test)
- libuser: don't commit object changes before passing data to service
  functions which might need differing data sets to figure out what to
  change (for example, ldap)- bind the internal mail spool creation/removal functions for python- renamed the python module
- revamped internals to use gobject's gvalues and gvaluearrays instead of
  glists of cached strings
- add enumeration-with-data functions to the C library- require linuxdoc-tools instead of sgml-tools for rawhide- fixup build files to allow building for arbitrary versions of python- link the python module against libpam
- attempt to import the python modules at build-time to verify dependencies- fix a file-parsing bug that popped up in 0.29's mmap modifications- quotaq: fix argument order when reading quota information
- user_quota: set quota grace periods correctly
- luseradd: never create home directories for system accounts- add da translation files
- update translations- add an explicit build dependency on jade (for the docs)- HUP nscd on modifications
- userutil.c: mmap files we're reading for probable speed gain
- userutil.c: be conservative with the amount of random data we read
- docs fixes- apps: print usage on errors
- lnewusers.c: initialize groups as groups, not users
- lnewusers.c: set passwords for new accounts
- luseradd.c: accept group names in addition to IDs for the -g flag
- luseradd.c: allow the primary GID to be a preexisting group- add ko transla>kp4@453nit script- rename samba logs (#11606)- initscript munging- configure the swat stuff usefully
- re-integrate some specfile tweaks that got lost somewhere- rebuild to get rid of cups dependency- tweak logrotate configurations to use the PID file in /var/lock/samba- rebuild in new environment- change PAM setup to use system-auth- fixes for ia64- switch to %configure- version 2.0.7- simplify preun- fix yp_get_default_domain in autoconf
- only link against readline for smbclient
- fix log rotation (#9909)- fix trigger, again.- fix trigger.- turn on quota support- rebuild to fox dependencies
- man pages are compressed- munge post scripts slightly- turn on mmap again. Wheee.
- ship smbmount on alpha- turn off mmap. ;)- change /var/log/samba to 0700
- turn on mmap support- update to 2.0.6- add a %defattr for -common- shift some files into -client
- remove /home/samba from package.- initscript oopsie. killproc <name> -HUP, not other way around.- script cleanups. Again.- add a patch to fix dropped reconnection attempts- use cp rather than mv to preserve /etc/services perms (#4938 et al).
- use mktemp to generate /etc/tmp.XXXXXX file name.
- add prereqs on sed/mktemp/killall (need to move killall to /bin).
- fix trigger syntax (i.e. "samba < 1.9.18p7" not "samba < samba-1.9.18p7")- sed "s|nawk|gawk|" /usr/bin/convert_smbpasswd- fix typo in mount.smb- add a %trigger to work around (sort of) broken scripts in
  previous releases- initscript munging- add domain parsing to mount.smb- add a -common package, shuffle files around.- add a chmod in %postun so /etc/services & inetd.conf don't become unreadable- update to 2.0.5
- fix mount.smb - smbmount options changed again.........
- fix postun. oops.
- update some stuff from the samba team's spec file.- split off clients into separate package
- don't run samba by default- fix one problem with mount.smb script
- fix smbpasswd on sparc with a really ugly kludge- fixed logrotate script- turn of 64-bit locking on 32-bit platforms- so many releases, so little time
- explicitly uncomment 'printing = bsd' in sample config- update to 2.0.4a
- fix mount.smb arg ordering- go back to stop/start for restart (-HUP didn't work in testing)- add a mount.smb to make smb mounting a little easier.
- smb filesystems apparently don't work on alpha. Oops.- always create codepages- logrotate changes- auto rebuild in the new build environment (release 3)- updated init script to use graceful restart (not stop/start)- update to 2.0.3- update to 2.0.2- swat swat- fix bash2 breakage in post script- update to 2.0.0- make sure all binaries are stripped- update to 1.9.18p10.
- fix %triggerpostun.- updated postun triggerscript to check $0
- clear /etc/codepages from %preun instead of %postun- made the %postun script a tad less agressive; no reason to remove
  the logs or lock file (after all, if the lock file is still there,
  samba is still running)
- the %postun and %preun should only exectute if this is the final
  removal
- migrated %triggerpostun from Red Hat's samba package to work around
  packaging problems in some Red Hat samba releases- minor tidy up in preparation for release of 1.9.18p5
- added findsmb utility from SGI package- Updated version and codepage info.
- Release to test name resolve order- Many optimisations (some suggested by Manoj Kasichainula <manojk@io.com>
- Use of chkconfig in place of individual symlinks to /etc/rc.d/init/smb
- Compounded make line
- Updated smb.init restart mechanism
- Use compound mkdir -p line instead of individual calls to mkdir
- Fixed smb.conf file path for log files
- Fixed smb.conf file path for incoming smb print spool directory
- Added a number of options to smb.conf file
- Added smbadduser command (missed from all previous RPMs) - Doooh!
- Added smbuser file and smb.conf file updates for username mapsmbfsbuilder17.centos.org 1460484884JJHJJ"J
JJJJJiPP_#@##c specific README- add provides pcsc-ifd-handler so which fulfills the pcsc-lite dependency for
  at least one reader.- update spec to meet Fedora package requirements- Increased timing again for FC5- rebuild for FC5- Added Requires for pcsc-lite
- fix attributes- Fixed problem where insertion did not always get detected- correct timing sleeps so slow tokens still work on fast machines.
- add make variables to control the install target location/bin/sh/bin/shbuilder10.centos.org 13299476670.05-17.el5ifd-egate.bundleContentsInfo.plistLinuxlibifd_egate.soifd-egate-0.05COPYING.LIBCOPYRIGHTChangeLogLICENSEPROTOCOLREADME/usr/lib64/pcsc/drivers//usr/lib64/pcsc/drivers/ifd-egate.bundle//usr/lib64/pcsc/drivers/ifd-egate.bundle/Contents//usr/lib64/pcsc/drivers/ifd-egate.bundle/Contents/Linux//usr/share/doc//usr/share/doc/ifd-egate-0.05/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII English textELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippedXML document textdirectoryPRRRRR? [	߉]c:4}[p?OEi䨤GV(6n&\)7tJ@7?KK.Też?OEi䨤GV(%' *)<r\ce鹯2׶TT9393bb328ce770dc68b3366e4695821289a9fccfOOOO]db50116345b0916904dbd15baafc65bbeb39a7526f214e2242e88ff5dee602e9153b0a26ae4305bc20282923d890d9bbd8c4e6c18dff36935fa2c251d4ccd06cbc19103eac654ccb944c76223a550d9b3c548b2404603dbddd2ccbeef9c07668d74d7124ad5d4bfba7ad3c1132130b05c56a585045a6a01543a2ecbde147490608c653dfc31c70331de51c5102406c868293d065c5c7c067e3706b47c8723025cbe3cf40e49d465b4c72e3fb984988cf9f14bd0c77028280a9c20728fee4344f7cf19e284b72c4b5ebc59cd9b123c64d3f6719c778b9f0wa7636d8aa351c27e3c367c7876ba810b6622e766v564a82e91c0bbe3b3b369fdd6298d26b0b45c903aa8e22ecfeefc6559ec73ee116a44d3e9c3b60718Tc2a0d24911cee30dcf9d9427bc26e33b267da44aL2097f6bf15fae7610b52cfa90a2769bcfe782006;f32ec0f50f7c75dd28e9e954d5c5a934a51e76559dfc5d0ec96533abbd25beaa65cc0daae11180b9c.7d1c50beca352a0d974c964548bc4bbec4b5d562-241c1aa1df3af0891c259862f075538661dbf16a+aa0ed4705617ed65574fb543d47c60415a7c6ced&ae68bf61a196e1aea443da4d247d0a7ce38d2cd2
3ceb9ba7aa49222b344cf2d578fff6d6dc0da1862dfac823f3ccdf2bde58918845e2a81a78b63d4c936edef6badbd1c616dda20ad9123c14f0eb9c31a33d4a3748367d8a7c1183e4cbdb54f888d47acb2a835549d27b66d7d90305ffb6f995a9105d5e1298a7263db32d71711376ed871fc6e173367c23cc3605ca87abf4fadbf8d0f0cc202d7168f25a21843a3e24dca96b48df2f25df2a682ccec274517db1e56dcef72c38c72a9c7aa97d2b5eb5de9dfaa864ed9fa2603b2c632a6bcf332fe28b2ac6777ed44c9bf284160d236bc52ab4bc7b723f79248623ed55c33488693b486271653899f949e45987615ccb0e}ae10e8fe4e059248b31b3348d8d80f1302112655y90932038f29e51f4a7d682287879be861b810631u5dd2b27c2628b997a415f349e6baaba9b1456444]0d1683006a1a50026ed48467acd1baa566d02127[b1463742802f27455a3f3fdc12ccea932966b451G97b8e49e30fa97043818dc108716fa236e8dbbae63fe5b98bb2b01597253922f11f47621f81f21a061665652ede709dc6ffc828fda838c661c00e8c6fa$e26302dc44ad9d5cf59507ddb07b618efcb228c012990c2d73a87874d6c4fe5d3ff047609a0eac129c16e748d07ac5bd2ec74123af2a433ab7519bb9
60985f49ebd7ef3655563b53b3d821cfbd82b53d_k!^Q@QRootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootzsh-4.2.6-10.el5_11.src.rpm'lp0@00014c108791ed4a02fc99acfb6c744ed55763bd0e8688a748d3c7d9894613f7e2b447bd232f87f7dbda823ce694f54bad13c287e745737db078a1fc8c54c748c4b1dc48c3f586b0647875b7f076538d826e14db3903050106de40f8d3cd9c37f5a3c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b6ae75e4a1b85f328565068a49cbb7f46ea444a883feb022a9499b7ba9dce39a60dfdf8798cdef7d80491bcae5938783db0efe2cc3b51ca79195a147ff575560305763216e9ad7e5a9c291d35dff15726866220d19a44bb9a0a670aa3af8db49e3c287e745737db078a1fc8c54c748c4bc83ca5a0fb748b6c6c879418a1f4b4dcfdf5a34b1e40c16e9312ce3a357053133c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b42eabea653df198d44c7350797e7a00e524f220dbadf9652cd3c14d4ad3e0df1c8a55c0c9c4a8fc1f1d3d337a09c69f8bc14900a12e82bfa5ec6c5f05065ea67ec34be55ff3e22bf100ca410f32f1b964ba85fd2ff7caa3c72b54cc7598f6856b225809e79b50eae6085ad4d299715dc3c287e745737db078a1fc8c54c748c4b765259b5ec64f937e752b2586f7d255e3c5c503ccf1ced7d3003ab02db962ad33c287e745737db078a1fc8c54c748c4b4f6add994313a4688f602185894179f73b3220c3f926c9164faa8135b741517413ad42073a82fa1fa5dfb1b440a512033675b32ce245f0f137468de704eab134038bdf08fcd45061c072e8b02db4f4bf3c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4bc163466daf0844d79483bf52bf1b51c73c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4bd3fe6d7d8c5eba8902f765bce3239d885e16ad2878147983f3fa6a72bf6c94123c287e745737db078a1fc8c54c748c4b639b1a00c1ba9c4b243e976b9f756389fb3d95f5a9f87fe26c99559c65344d7551fd1dce0701215fb71871c00ef604c639bf1f309c758294baaac9bb2d9aa1a8c576d03652ca0dc186cfa0785e72ca05c576d03652ca0dc186cfa0785e72ca05consolehelperrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsystem-config-kdump-1.0.14-5.el5_9.src.rpmconfig(system-config-kdump)system-config-kdump@@@L@JJ/bin/sh/bin/sh/bin/shbitmap-fontsconfig(system-config-kdump)gtk2hicolor-icon-themekexec-toolsmkinitrdpygtk2pygtk2-libgladeredhat-artworkrhplrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)usermode1.0.14-5.el5_92.8.202.8.60.61-10.185-13.0.4-14.0-11.364.4.2.3Q_I`H,`H`HB`G`G!`FF`EJEEE`EuEnEB`EA/EA/EA/EA/E>E7`E6E4E0`E,E&Martin Milata <mmilata@redhat.com> 1.0.14-5Roman Rakus <rrakus@redhat.com> 1.0.k^@t expected to be part of the key in the db file,
  matching the behavior of db_load 3.2.9- pam_unix: use crypt() instead of bigcrypt() when salted field is less than
  the critical size which lets us know it was generated with bigcrypt()
- use a wrapper to handle ERANGE errors when calling get....._r functions:
  defining PAM_GETPWNAM_R and such (for getpwnam, getpwuid, getgrnam,
  getgrgid, and getspnam) before including _pam_macros.h will cause them
  to be implemented as static functions, similar to how defining PAM_SM_xxx
  is used to control whether or not PAM declares prototypes for certain
  functions- pam_unix: argh, compare entire pruned salt string with crypted result, always- ship /lib/lib{pam,pam_misc}.so for legacy package builds- noreplace configuration files in /etc/security
- pam_console: update pam_console_apply and man pages to reflect
  /var/lock -> /var/run move- pam_unix: fix the fix for #42394- modules: use getpwnam_r and friends instead of non-reentrant versions
- pam_console: clear generated .c and .h files in "clean" makefile target- pam_stack: perform deep copy of conversation structures
- include the static libpam in the -devel subpackage (#52321)
- move development .so and .a files to %{_libdir}
- pam_unix: don't barf on empty passwords (#51846)
- pam_unix: redo compatibility with "hash,age" data wrt bigcrypt (#42394)
- console.perms: add usb camera, scanner, and rio devices (#15528)
- pam_cracklib: initialize all options properly (#49613)- pam_limits: don't rule out negative priorities- pam_xauth: fix errors due to uninitialized data structure (fix from Tse Huong
  Choo)
- pam_xauth: random cleanups
- pam_console: use /var/run/console instead of /var/lock/console at install-time
- pam_unix: fix preserving of permissions on files which are manipulated- fix segfault in pam_securetty- pam_console: use /var/run/console instead of /var/lock/console for lock files
- pam_issue: read the right number of bytes from the file- pam_wheel: don't error out if the group has no members, but is the user's
  primary GID (reported by David Vos)
- pam_unix: preserve permissions on files which are manipulated (#43706)
- pam_securetty: check if the user is the superuser before checking the tty,
  thereby allowing regular users access to services which don't set the
  PAM_TTY item (#39247)
- pam_access: define NIS and link with libnsl (#36864)- link libpam_misc against libpam- pam_chroot: chdir() before chroot()- pam_console: fix logic bug when changing permissions on single
  file and/or lists of files
- pam_console: return the proper error code (reported and patches
  for both from Frederic Crozat)
- change deprecated Copyright: tag in .spec file to License:- console.perms: change js* to js[0-9]*
- include pam_aconf.h in more modules (patches from Harald Welte)- console.perms: add apm_bios to the list of devices the console owner can use
- console.perms: add beep to the list of sound devices- link pam_console_apply statically with libglib (#38891)- pam_access: compare IP addresses with the terminating ".", as documented
  (patch from Carlo Marcelo Arenas Belon, I think) (#16505)- merge up to 0.75
- pam_unix: temporarily ignore SIGCHLD while running the helper
- pam_pwdb: temporarily ignore SIGCHLD while running the helper
- pam_dispatch: default to uncached behavior if the cached chain is empty- correct speling errors in various debug messages and doc files (#33494)- prereq sed, fileutils (used in %post)- remove /dev/dri from console.perms -- XFree86 munges it, so it's outside of
  our control (reminder from Daryll Strauss)
- add /dev/3dfx to console.perms- pam_wheel: make 'trust' and 'deny' work together correctly
- pam_wheel: also check the user's primary gid
- pam_group: also initialize groups when called with PAM_REINITIALIZE_CRED- mention pam_console_apply in the see also section of the pam_console man pages- console.perms: /dev/vc/* should be a regexp, not a glob (thanks to
  Charles Lopes)- console.perms: /dev/cdroms/* should belong to the user, from Dou,l-@nxsgbVQE@4/#
ythcWRFA50$














z
u
i
d
X
S
G
B
6
1
%
 



{vjeYTHC72&!|wkfZUID83'"













}
x
l
g
[
V
J
E
9
4
(
#




														~	y	m	h	\	W	K	F	:	5	)	$					zni]XLG;6*%{oj^YMH<7+&	|pk_ZNI=8,'
A:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:0NA:00yA:.xA:.A:/.d9A:-xA:-ؠA:(-A:,$xA:,^pA:<,KhA:+@`A:+LXA:@PA:0+HA:'@A:?	 8A:xK0A:\\(A:l% A:?A:x	IA:j	gA:BA:;A:A:A:A:
A:A:̛A:.BA:phA:t;A:	sA:lFA:\A::,pA:$)ss$&rC$$2$#"$#$#L$ Xl
<lt9l,DJ|2,1ز
>U |L(iX+Ouu)mO 5e`=]XU؈M
=x5-B[%H?
=

`KH%l@
8
 
tK
hd
T
jL0"$!lv0i#2$XcX;n])pY%wogP_OnG8'7G/k @ change users passwords when helper is needed (#476904)
- make package's requires more correct (#497570)- pam_tally2: add serialize option (#455217)- add pam_tty_audit module (#244352)
- pam_cracklib: additional optional checks for password quality (#438994)
- pam_lastlog: display failed login attempts if requested (#438990)
- pam_unix: do not check new passwords through cracklib (#448860)
- pam_unix: clear PAM_AUTHTOK item if new password is bad (#443872)
- comment in the limits.conf manpage that rss limit is ignored (#459624)
- allow larger entries in pammodutil_get functions (#445355)
- pam_tally: do not leak fds in tally_check (#457024)
- pam_loginuid: use correct format when printing uid type (#460263)
- pam_rhosts_auth: correct test for IP address (#461917)- support sha256 and sha512 password hashes (#427389)
- fixed in operator of pam_succeed_if module (#295151)
- fixed audit option of pam_tally and pam_tally2 (#328281)
- do not free putenved pointer in pam_xauth (#402391)- removed realtime default limits (#240123) from the package as
  it caused regression on machines with nonexistent realtime group- added and improved translations (#219124)
- adjusted the default limits for realtime users (#240123)- pam_unix: truncated MD5 passwords in shadow shouldn't match (#219258)
- pam_limits: add limits.d support (#232700)
- pam_limits, pam_time, pam_access: add auditing of failed logins (#232993)
- pam_namespace: expand $HOME even when appended with text (#237163)
  original patch by Ted X. Toth
- add some default limits for users in realtime group (#240123)
- CVE-2007-3102 - prevent audit log injection through user name (#243204)- make unix_update helper executable only by root as it isn't
  useful for regular user anyway- pam_namespace: better document behavior on failure (#237249)
- pam_unix: split out passwd change to a new helper binary (#236316)- pam_selinux: improve context change auditing (#234781)- pam_console: always decrement use count (#233581)
- pam_namespace: fix parsing config file with unknown users (#234513)- pam_namespace: unmount poly dir for override users (#229689)
- pam_namespace: use raw context for poly dir name (#227345)
- pam_namespace: truncate long poly dir name (append hash) (#230120)- correctly relabel tty in the default case (#229542)- properly include /var/log/faillog and tallylog as ghosts
  and create them in post script (#209646)- Update gmo files as we patch some po files (#218271)- Add use_current_range option to pam_selinux (#220487)- Add proper audit message to indicate selected context
- Resolves: #220652- Try again to Fix pam_selinux to select role correctly
- Resolves: #220652- Fix pam_selinux to select role correctly
- Resolves: #220652- Fix pam_namespace to work with cron  
- Resolves: #216184- No shortcut on Password: in ja locale (#218271)
- Revert to old euid and not ruid when setting euid in pam_keyinit (#219486)
- Fix no answer to select_context question (#213812)
- Rename selinux-namespace patch to namespace-level- Add level polyinstantiation option to pam_namespace to only
  change MLS component (#216184)- add select-context option to pam_selinux (#213812)- move setgid before setuid in pam_keyinit (#212329)
- make username check in pam_unix consistent with useradd (#212153)- don't overflow a buffer in pam_namespace (#211989)- /var/log/faillog and tallylog must be %config(noreplace)- preserve effective uid in namespace.init script (LSPP for newrole)
- include /var/log/faillog and tallylog to filelist (#209646)
- add ids to .xml docs so the generated html is always the same (#210569)- add pam_namespace option no_unmount_on_close, required for newrole- silence pam_succeed_if in default system-auth (#205067)
- round the pam_timestamp_check sleep up to wake up at the start of the
  wallclock second (#205068)- upgrade to new upstream version, as there are mostly bugfixes except
  improved documentation
- add support for session and password service for pam_access and
  pam_succeed_if
- system-auth: skip session pam_unix foriP(	)@)))7.2-2Brent Fox <bfox@redhat.com> 0.7.1-6Brent Fox <bfox@redhat.com> 0.7.1-5Jeremy Katz <katzj@redhat.com> 0.7.1-4Brent Fox <bfox@redhat.com> 0.7.1-3Brent Fox <bfox@redhat.com> 0.7.1-2Brent Fox <bfox@redhat.com> 0.7.1-1Brent Fox <bfox@redhat.com> 0.7.0-6Brent Fox <bfox@redhat.com> 0.7.0-5Brent Fox <bfox@redhat.com> 0.7.0-4Brent Fox <bfox@redhat.com> 0.7.0-2Brent Fox <bfox@redhat.com> 0.7.0-1Michael Fulbright <msf@redhat.com> 0.6.9-1Alexander Larsson <alexl@redhat.com>Alexander Larsson <alexl@redhat.com>Jeremy Katz <katzj@redhat.com> 0.6.6-1Alexander Larsson <alexl@redhat.com> 0.6.5-1Alexander Larsson <alexl@redhat.com> 0.6.4-1Alexander Larsson <alexl@redhat.com> 0.6.3-1Alexander Larsson <alexl@redhat.com> 0.6.2-1Preston Brown <pbrown@redhat.com> 0.6.1-1Alexander Larsson <alexl@redhat.com> 0.6.0-1Preston Brown <pbrown@redhat.com> 0.5.2-1Alexander Larsson <alexl@redhat.com>Alexander Larsson <alexl@redhat.com> 0.3.1-1Alexander Larsson <alexl@redhat.com>Alex Larsson <alexl@redhat.com>Alex Larsson <alexl@redhat.com>Alex Larsson <alexl@redhat.com> 0.1.0-1Alex Larsson <alexl@redhat.com>- scd-1.0.48-nv-dualhead.patch: Disable dualhead UI for nv driver (#430579)
- scd-1.0.48-dualhead-force.patch: Fix enabling dualhead, clicking OK, not
  selecting a monitor, and clicking OK again (#755542)
- Remove bizarre preun scriptlet (#771740)- Rebuild for translations.- Add dist tag to Release.- Import old driver list code from rhpxl. (#218241)- Fail gracefully on machines with no video.- Fix mnemonic for the color depth combo on the last tab (#216391)- Refresh the mode state before first paint, to give rhpxl a chance to ask
  RANDR for the current mode.- Unpack properly when given a refresh rate instead of a refresh range.- Drop 8bpp support.
- Simplify monitor selection view.
- Fix initial window sizing to be large enough for all fields.- Align lists correctly in RTL locales.  (#202754)- adjust to new rhpxl (<clumens@redhat.com>)
- work with newer, sparser, config files
- when dealing with autoprobed monitors, pull current resolution from randr- Fix CHARSET in te and kn translations (#200203).
- Add gettext to buildrequires.- Add back spec file parts that got lost on last rebuild.- Initialize monitor name label to something other than unknown if we
  really know what it is.- added pam fix (#170625)
- fix prereq (#182861, #182862)- Add rhpxl to requires- Rebuild for translations
- Fix reconfig mode- Rebuild- Some s/rhpl/rhpxl/ type changes- minor changes needed for modular X- Fix up some leftover code that still needed migration (#168932)- Adapt to new kudzu video driver probing, and new rhpl- Add ppc64 to ExcludeArchs- put scriptlets from distcvs in this specfile- fix typo in cleanup leading to traceback (#157423)- Clean up deprecation warnings (#153937)- Only merge hardware_state if defined (#143944)
- Only print card if verbose (#143271)- Dual Head patch for testing thanks to Marc Andre Morissette (#136916)- Firstboot - re-read config so both kbd and display changes persist (#135361)- Depth callback patch from twaugh (#128650)- fix mouse traceback- Refactor some stuff into rhpl
- Don't override driver changes unless in reconfig (#127779)- Translatable desktop
- Layout changes for firstboot screen- Ensure selection string translatable- Monitor selection for first boot- initialize self.probed_path in videocardDialog.py (bug #113695)- reduce size of monitor-off.png and monitor-on.png to fit in 640x480 (bug #122142)- set the text domain for xconf.py and xConfigDialog.py (bug #123494)- fix --reconfig and catch some exceptions for readonly root- add BuildRequires for desktop-file-utils (bug# 124181)- do not write out extra XF86Config file during firstboot (bug #121729)- Do not write out XkbRules line to config file, as it is unnecessary to hard
  code the rules file, which has a built in default which should always
  work. (#120858)- update requires for new pyxf86config- make changes for XFree86 -> Xorg conversion- fix icon path (bug #120174)- j@@st called with f_sema held (Jeff Layton ) [453094]
- [x86] don't call MP_processor_info for disabled cpu (Prarit Bhargava ) [455425]
- [x86_64] don't call MP_processor_info for disabled cpu (Prarit Bhargava ) [455427]
- [x86] show apicid in /proc/cpuinfo (Prarit Bhargava ) [455424]
- [acpi] disable lapic timer on C2 states (John Villalovos ) [438409]
- [acpi] enable deep C states for idle efficiency (Matthew Garrett ) [443516]
- [fs] missing check before setting mount propagation (Eugene Teo ) [454393]
- [xen] pvfb: frontend mouse wheel support (Markus Armbruster ) [446235]
- [ppc] use ibm,slb-size from device tree (Brad Peters ) [432127]
- [mm] dio: fix cache invalidation after sync writes (Jeff Moyer ) [445674]
- [misc] fix UP compile in skcipher.h (Prarit Bhargava ) [453038]
- [ia64] softlock: prevent endless warnings in kdump (Neil Horman ) [453200]
- [net] s2io: fix documentation about intr_type (Michal Schmidt ) [450921]
- [net] make udp_encap_rcv use pskb_may_pull (Neil Horman ) [350281]
- [misc] fix compile when selinux is disabled (Prarit Bhargava ) [452535]
- [scsi] update aacraid to 1.1.5-2455 (Chip Coldwell ) [429862]
- [x86_64] ptrace: sign-extend orig_rax to 64 bits (Jerome Marchand ) [437882]
- [x86_64] ia32 syscall restart fix (Jerome Marchand ) [434998]
- [misc] optimize byte-swapping, fix -pedantic compile (Jarod Wilson ) [235699]
- [dm] snapshot: reduce default memory allocation (Milan Broz ) [436494]
- [dm] snapshot: fix chunksize sector conversion (Milan Broz ) [443627]
- [net] ip tunnel can't be bound to another device (Michal Schmidt ) [451196]
- [net] bnx2x: chip reset and port type fixes (Andy Gospodarek ) [441259]
- [audit] records sender of SIGUSR2 for userspace (Eric Paris ) [428277]
- [audit] deadlock under load and auditd takes a signal (Eric Paris ) [429941]
- [audit] send EOE audit record at end of syslog events (Eric Paris ) [428275]
- [x86] brk: fix RLIMIT_DATA check (Vitaly Mayatskikh ) [315681]
- [misc] fix ?!/!? inversions in spec file (Jarod Wilson ) [451008]
- [scsi] fix high I/O wait using 3w-9xxx (Tomas Henzl ) [444759]
- [net] ipv6: fix unbalanced ref count in ndisc_recv_ns (Neil Horman ) [450855]
- [fs] cifs: wait on kthread_stop before thread exits (Jeff Layton ) [444865]
- [net] fix the redirected packet if jiffies wraps (Ivan Vecera ) [445536]
- [nfs] pages of a memory mapped file get corrupted (Peter Staubach ) [435291]
- [net] sunrpc: memory corruption from dead rpc client (Jeff Layton ) [432867]
- [fs] debugfs: fix dentry reference count bug (Josef Bacik ) [445787]
- [acpi] remove processor module errors (John Feeney ) [228836]
- [fs] ext3: make fdatasync not sync metadata (Josef Bacik ) [445649]
- [pci] acpiphp_ibm: let ACPI determine _CID buffer size (Prarit Bhargava ) [428874]
- [fs] need process map reporting for swapped pages (Anton Arapov ) [443749]
- [misc] optional panic on softlockup warnings (Prarit Bhargava ) [445422]
- [net] sctp: support remote address table oid (Neil Horman ) [435110]
- [nfs] knfsd: revoke setuid/setgid when uid/gid changes (Jeff Layton ) [443043]
- [nfs] remove error field from nfs_readdir_descriptor_t (Jeff Layton ) [437479]- [nfs] sunrpc: sleeping rpc_malloc might deadlock (Jeff Layton ) [451317]
- [gfs2] initial write performance very slow (Benjamin Marzinski ) [432826]
- [ia64] avoid unnecessary TLB flushes when allocating mem (Doug Chapman ) [435362]
- [gfs2] lock_dlm: deliver callbacks in the right order (Bob Peterson ) [447748]
- [sound] alsa: HDA driver update from upstream 2008-06-11 (Jaroslav Kysela ) [451007]
- [x86_64] xen: fix syscall return when tracing (Chris Lalancette ) [453394]
- [fs] ext3: lighten up resize transaction requirements (Eric Sandeen ) [425955]
- [xen] PVFB probe & suspend fixes (Markus Armbruster ) [434800]
- [nfs] ensure that options turn off attribute caching (Peter Staubach ) [450184]
- [x86_64] memmap flag results in bogus RAM map output (Prarit Bhargava ) [450244]
- [nfs] sunrpc: fix a race in rpciod_down (Jeff Layton ) [448754]
- [nfs] sunrpc: fix hang due to eventd deadlock (Jl.@...portant options
	- add /etc/pam.d/smtp for AUTH
	- add FEATURE(use_ct_file) and /etc/mail/trusted-users- don't obsolete postfix and exim, only conflict (for RHN purposes)- obsolete and conflict with exim and postfix- fix devision by zero bug in #20395
- mv /usr/lib/sendmail-cf /usr/share/sendmail-cf- i18n tweaks to initscript- aliases.db should be owned by group root- prepare for startup-script translation- enable daemon mode again, but only listen to the loopback device
  instead of all devices.
- do not include check.tar with old anti-spam rules- fix configuration of /etc/aliases- fix interoperation problems with communigate pro
- disable msa- update to (security release) 8.11.2
- build also on RHL 6.x #16061
- include smrsh man-page #17901
- use the "-f" flag for makemap to preserve case for virtusertable
  and userdb in /etc/mail/Makefile - suggested by Harald Hoyer
- fix /usr/doc -> usr/share/doc in docu #20611
- wrong path in sendmail.mc #20691
- tcp-wrapper support wasn't enabled correctly #21642
- do not expose user "root" when masquerading like in older releases #21643
- disable the VRFY and EXPN smtp commands #21801
- disable queue-runs for normal users (restrictqrun privacy flag)
- fix typo in sendmail.mc #21880, #22682
- disable daemon mode to see what needs fixing- update to 8.11.1- rebuild in new environment- apply fixes for LDAP maps being closed too soon- provide /usr/lib/sasl/Sendmail.conf so that people know we can use it (#16064)- enable listening on the smtp port again- fix "missing find_m4.sh" problem by defining M4=/usr/bin/m4 (#14767)- okay, enable LDAP support again
- enable SMTP auth support via Cyrus SASL- disable the LDAP support until we can remove the sendmail->OpenLDAP->perl dep
- fix prereq- update to sendmail 8.11.0
- add LDAP support- move initscript back- automatic rebuild- require procmail
- add further aliases- prereq init.d
- fix typo- ignore error from useradd- FHS fixes
- /etc/rc.d/init.d -> /etc/init.d
- fix initscript- change to /usr/share/man- turn off daemon behaviour by default- rebuild, fix dependencies- prereq /usr/sbin/useradd- enable MAP_REGEX
- enable tcp_wrapper support- fix etc/mail/aliases -> /etc/aliases in sendmail-redhat.mc- update to 8.10.1
- fix build without sendmail installed
- add 'mailnull' user- update to 8.10.0
- remove compatiblity chkconfig links
- add a mailnull user for sendmail to use- break the hard link for makemap and create it as a symlnk (#8223)- Fix location of mailertable (Bug #6035)- fixes for non-root builds (#8178)- change perms on /etc/sysconfig/sendmail from 0755 to 0644
- allow compressed man-pages- add patch to prevent the DoS when rebuilding aliases- install man pages, not groff output (#3746).
- use dnl not '#' in m4 comment (#3749).
- add FEATURE(mailtertable) to the config -- example file needs this (#4649).
- use db2 not db1.- add 127.0.0.1 to /etc/mail/access to avoid IDENT: relay problem (#3178).- chkconfig --del in preun, not postun (#3982)- initscript munging- fixed typo bug in comment in the default .mc file (#2812)- fox the awk scripts in the postinstall
- enable FEATURE(accept_unresolvable_domains) by default to make laptop
  users happy.- make the redhat.mc be a separate source files. Sanitize patches that used
  to touch it.
- install redhat.mc as /etc/sendmail.mc so that people can easily modify
  their sendmail.cf configurations.- fixed virtusertable patch
- make smrsh look into /etc/smrsh- remove noreplace attr from sednmail.cf.- provide a more sane /etc/mail/access default config file
- use makemap to initializa the empty databases, not touch
- added a small, but helpful /etc/mail/Makefile- correxct dangling symlinks.
- check for map file existence in %post.- auto rebuild in the new build environment (release 3)- improved 8.9.3 config from Mike McHenry <mmchen@minn.net>- version 8.9.3- build for 6.0
- use the libdb1 stuff correctly- Allow empty QUEUE in /etc/sysconfig/sendmail for those who
  want to run sendmail in daemon mode without processikx	?	@?	>	HH?Md		<	.4<
p
	





L



P(8*9X*:~*>g@vFG
H
I
JX$Y4\D
]x
^)bd"e'f,k.l3tL
u
v	w
xL
y0{@
`dtAA
 $
4K8g@hDCpcre6.69.el5Perl-compatible regular expression libraryPerl-compatible regular expression library.
PCRE has its own native API, but a set of "wrapper" functions that are based on
the POSIX API are also supplied in the library libpcreposix. Note that this
just provides a POSIX calling interface to PCRE: the regular expressions
themselves still follow Perl syntax and semantics. The header file
for the POSIX-style functions is called pcreposix.h.RK	builder17.centos.orgCentOS-5CentOSBSDSystem Environment/Librarieshttp://www.pcre.org/linuxi386Q`s8	A큤RKRKRKRKRKRKRKRKRKC>LC>LRKRK1aeadcaacc67c5f313ac76bf63388ae027f1d1a6a8abb30c01d7fd6c9803337ce165658e782d5d5f1cc5c55a804854cc48853eb72f6b4ed3b1f9b6940659f71cfa355baf5c943e6c660603f97eded1b547abf1217164c31fee13473bc737c51ca86c914b9125ec4b0572860c4ef73435b996b7a7ca6bd26bdd4862944a7f4c0da0c417b881005e1878bb8cd0372c8f2clibpcre.so.0.0.1libpcrecpp.so.0.0.0libpcreposix.so.0.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpcre-6.6-9.el5.src.rpmlibpcre.so.0libpcrecpp.so.0libpcreposix.so.0pcre@@@@@@@@@@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfig/sbin/ldconfiglibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libgcc_s.so.1libgcc_s.so.1(GCC_3.0)libm.so.6libpcre.so.0libpcrecpp.so.0libpcreposix.so.0libstdc++.so.6libstdc++.so.6(CXXABI_1.3)libstdc++.so.6(GLIBCXX_3.4)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.4-14.0-14.4.2.3QmQhMlLGmGPG:`G:`G4`GDpDaCC`C`CB(`B
*A`A`@q`@``@R2@E@-H?t>k>>/`>-=ި=I=`==H==<f`<`<?``;`;I:`Petr Pisar <ppisar@redhat.com> - 6.6-9Petr Pisar <ppisar@redhat.com> - 6.6-8Petr Pisar <ppisar@redhat.com> - 6.6-7Petr Pisar <ppisar@redhat.com> - 6.6-6Stepan Kasal <skasal@redhat.com> - 6.6-5Stepan Kasal <skasal@redhat.com> - 6.6-4Stepan Kasal <skasal@redhat.com> - 6.6-3Josh Bressers <bressers@redhat.com> 6.6-2.4Than Ngo <than@redhat.com> 6.6-2.3Jesse Keating <jkeating@redhat.com> - 6.6-1.1Than Ngo <than@redhat.com> 6.6-1Jesse Keating <jkeating@redhat.com> - 6.3-1.2.1Jesse Keating <jkeating@redhat.com> - 6.3-1.2Jesse Keating <jkeating@redhat.com>Than Ngo <than@redhat.com> 6.3-1Joe Orton <jorton@redhat.com> 5.0-4Joe Orton <jorton@redhat.com> 5.0-3Joe Orton <jorton@redhat.com> 5.0-2Than Ngo <than@redhat.com> 5.0-1Elliot Lee <sopwith@redhat.com>TjBpc	@face version for 3.1 (Kei Tokunaga ) [242989]
- [xen] ia64: Fix PV-on-HVM driver (Kei Tokunaga ) [242144]
- [xen] ia64: use generic swiotlb.h header (Kei Tokunaga ) [242138]
- [xen] ia64: xm save/restore does not work (Kei Tokunaga ) [240858]
- [xen] ia64: Skip MCA setup on domU (Kei Tokunaga ) [242143]
- [xen] ia64: Cannot measure process time accurately (Kei Tokunaga ) [240107]
- [xen] Support new xm command: xm trigger (Kei Tokunaga ) [242140]
- [xen] ia64: Fix for irq_desc() missing in new upstream (Kei Tokunaga ) [242137]
- [xen] ia64: Set IRQ_PER_CPU status on percpu IRQs (Kei Tokunaga ) [242136]
- [xen] ia64: improve performance of system call (Kei Tokunaga ) 
- [xen] ia64: para domain vmcore does not work under crash (Kei Tokunaga ) [224047]
- [xen] ia64: kernel-xen panics when dom0_mem=4194304 is specified (Kei Tokunaga ) [217593]
- [xen] ia64: evtchn_callback fix and clean (Kei Tokunaga ) [242126]
- [xen] ia64: changed foreign domain page mapping semantic (Kei Tokunaga ) [242779]
- [xen] Change to new interrupt deliver mechanism (Kei Tokunaga ) [242125]
- [xen] ia64: Uncorrectable error makes hypervisor hung (MCA  support) (Kei Tokunaga ) [237549]
- [xen] Xen0 can not startX in tiger4 (Kei Tokunaga ) [215536]
- [xen] ia64: Fix xm mem-set hypercall on IA64 (Kei Tokunaga ) [241976]
- [xen] ia64: Fix HVM interrupts on IPF (Kei Tokunaga ) [242124]
- [xen] save/restore fix (Gerd Hoffmann ) [222128]
- [xen] blkback/blktap: fix id type (Gerd Hoffmann ) [222128]
- [xen] xen: blktap race #2 (Gerd Hoffmann ) [222128]
- [xen] blktap: race fix #1 (Gerd Hoffmann ) [222128]
- [xen] blktap: cleanups. (Gerd Hoffmann ) [242122]
- [xen] blktap: kill bogous flush (Gerd Hoffmann ) [222128]
- [xen] binmodal drivers: block backends (Gerd Hoffmann ) [222128]
- [xen] bimodal drivers, blkfront driver (Gerd Hoffmann ) [222128]
- [xen] bimodal drivers, pvfb frontend (Gerd Hoffmann ) [222128]
- [xen] bimodal drivers, protocol header (Gerd Hoffmann ) [222128]- [net] netxen: initial support for NetXen 10GbE NIC (Andy Gospodarek ) [231724]
- [net] cxgb3: initial support for Chelsio T3 card (Andy Gospodarek ) [222453]
- [drm] agpgart and drm support for bearlake graphics (Geoff Gustafson ) [229091]
- [acpi] acpi_prt list incomplete (Kimball Murray ) [214439]
- [mm] memory tracking patch only partially applied to Xen kernel (Kimball Murray ) [242514]
- [x86_64] Fix TSC reporting for processors with constant TSC (Bhavana Nagendra ) [236821]
- [pci] irqbalance causes oops during PCI removal (Kimball Murray ) [242517]
- [net] Allow packet drops during IPSec larval state resolution (Vince Worthington ) [240902]
- [net] bcm43xx: backport from 2.6.22-rc1 (John W. Linville ) [213761]
- [net] softmac: updates from 2.6.21 (John W. Linville ) [240354]
- [net] e1000: update to driver version 7.3.20-k2 (Andy Gospodarek ) [212298]
- [net] bnx2: update to driver version 1.5.11 (Andy Gospodarek ) [225350]
- [net] ipw2[12]00: backports from 2.6.22-rc1 (John W. Linville ) [240868]
- [net] b44 ethernet driver update (Jeff Garzik ) [244133]
- [net] sky2: update to version 1.14 from 2.6.21 (John W. Linville ) [223631]
- [net] forcedeth: update to driver version 0.60 (Andy Gospodarek ) [221941]
- [net] bonding: update to driver version 3.1.2 (Andy Gospodarek ) [210577]
- [net] tg3: update to driver version 3.77 (Andy Gospodarek ) [225466 228125]
- [PPC] Update of spidernet to 2.0.A for Cell (Scott Moser ) [227612]
- [scsi] SPI DV fixup (Chip Coldwell ) [237889]
- [audit] audit when opening existing messege queue (Eric Paris ) [223919 ]
- [audit] audit=0 does not disable all audit messages (Eric Paris ) [231371]
- [net] mac80211 inclusion (John W. Linville ) [214982 223558]- [sata] kabi fixes [203781]
- [audit] panic and kabi fixes [233021]- [x86_64] sparsemem memmap allocation above 4G (grgustaf) [227426]
- [net] ip_conntrack_sctp: fix remotely triggerable panic (Don Howard ) [243244] {CVE-2007-2876}
- [usb] Strange URBs and running out IOMMU (Pete Zaitcev ) [230427]
- [audit] broken class-based syscall audit (Eric Paris ) [239887]
- [&k`@pattern.txt.gzpi_gzip.txt.gzpi_netrw.txt.gzpi_paren.txt.gzpi_spec.txt.gzpi_tar.txt.gzpi_vimball.txt.gzpi_zip.txt.gzprint.txt.gzquickfix.txt.gzquickref.txt.gzquotes.txt.gzrecover.txt.gzremote.txt.gzrepeat.txt.gzrileft.txt.gzrussian.txt.gzscroll.txt.gzsign.txt.gzspell.txt.gzsponsor.txt.gzsql.txt.gzstarting.txt.gzsyntax.txt.gztabpage.txt.gztagstagsrch.txt.gzterm.txt.gztips.txt.gztodo.txt.gzuganda.txt.gzundo.txt.gzusr_01.txt.gzusr_02.txt.gzusr_03.txt.gzusr_04.txt.gzusr_05.txt.gzusr_06.txt.gzusr_07.txt.gzusr_08.txt.gzusr_09.txt.gzusr_10.txt.gzusr_11.txt.gzusr_12.txt.gzusr_20.txt.gzusr_21.txt.gzusr_22.txt.gzusr_23.txt.gzusr_24.txt.gzusr_25.txt.gzusr_26.txt.gzusr_27.txt.gzusr_28.txt.gzusr_29.txt.gzusr_30.txt.gzusr_31.txt.gzusr_32.txt.gzusr_40.txt.gzusr_41.txt.gzusr_42.txt.gzusr_43.txt.gzusr_44.txt.gzusr_45.txt.gzusr_90.txt.gzusr_toc.txt.gzvarious.txt.gzversion4.txt.gzversion5.txt.gzversion6.txt.gzversion7.txt.gzvi_diff.txt.gzvim2html.plvisual.txt.gzwindows.txt.gzworkshop.txt.gzevim.vimfiletype.vimftoff.vimftpluginftplugin.vimAppendMatchGroup.vimREADME.txta2ps.vimaap.vimabaqus.vimada.vimalsaconf.vimant.vimarch.vimart.vimaspvbs.vimautomake.vimbdf.vimbtm.vimc.vimcalendar.vimch.vimchangelog.vimconf.vimconfig.vimcontext.vimcpp.vimcrm.vimcs.vimcsc.vimcsh.vimcss.vimcvsrc.vimdebchangelog.vimdictconf.vimdictdconf.vimdiff.vimdircolors.vimdosbatch.vimdtd.vimelinks.vimeruby.vimeterm.vimfetchmail.vimflexwiki.vimfortran.vimfvwm.vimgpg.vimgroup.vimgrub.vimhaskell.vimhelp.vimhtml.vimindent.viminitex.vimishd.vimjava.vimjavascript.vimjsp.vimkconfig.vimkwt.vimld.vimlftp.vimlibao.vimlimits.vimlisp.vimloginaccess.vimlogindefs.vimlprolog.vimlua.vimm4.vimmail.vimmailaliases.vimmailcap.vimmake.vimman.vimmanconf.vimmatlab.vimmf.vimmodconf.vimmp.vimmplayerconf.vimmrxvtrc.vimmupad.vimmuttrc.vimnanorc.vimnetrc.vimobjc.vimocaml.vimoccam.vimpamconf.vimpascal.vimpasswd.vimperl.vimphp.vimpinfo.vimplaintex.vimpostscr.vimprocmail.vimprolog.vimprotocols.vimpyrex.vimpython.vimquake.vimracc.vimreadline.vimrnc.vimrpl.vimrst.vimruby.vimscheme.vimscreen.vimsensors.vimservices.vimsetserial.vimsgml.vimsh.vimsieve.vimslpconf.vimslpreg.vimslpspi.vimspec.vimsql.vimsshconfig.vimsudoers.vimsvg.vimsysctl.vimtcsh.vimterminfo.vimtex.vimudevconf.vimudevperm.vimudevrules.vimupdatedb.vimvb.vimverilog.vimvhdl.vimvim.vimxdefaults.vimxf86conf.vimxhtml.vimxinetd.vimxml.vimxmodmap.vimxs.vimxsd.vimxslt.vimyaml.vimzsh.vimftplugof.vimgvimrc_example.vimindentindent.vimGenericIndent.vimREADME.txtaap.vimada.vimant.vimautomake.vimawk.vimbib.vimc.vimcdl.vimch.vimchangelog.vimcmake.vimconfig.vimcpp.vimcs.vimcss.vimd.vimdictconf.vimdictdconf.vimdocbk.vimdylan.vimeiffel.vimeruby.vimeterm.vimfortran.vimhtml.vimidlang.vimishd.vimjava.vimld.vimlisp.vimlua.vimmake.vimmatlab.vimmma.vimmp.vimmupad.vimobjc.vimocaml.vimoccam.vimpascal.vimperl.vimphp.vimpostscr.vimpov.vimprolog.vimpyrex.vimpython.vimreadline.vimrpl.vimrst.vimruby.vimscheme.vimsdl.vimsh.vimsml.vimsql.vimsqlanywhere.vimtcl.vimtcsh.vimtilde.vimvb.vimverilog.vimvhdl.vimvim.vimxf86conf.vimxhtml.vimxinetd.vimxml.vimxsd.vimxslt.vimyacc.vimzsh.vimindoff.vimkeymapREADME.txtaccents.vimarabic.vimarabic_utf-8.vimbulgarian.vimcanfr-win.vimczech.vimczech_utf-8.vimesperanto.vimesperanto_utf-8.vimgreek.vimgreek_cp1253.vimgreek_cp737.vimgreek_iso-8859-7.vimgreek_utf-8.vimhebrew.vimhebrew_cp1255.vimhebrew_iso-8859-8.vimhebrew_utf-8.vimhebrewp.vimhebrewp_cp1255.vimhebrewp_iso-8859-8.vimhebrewp_utf-8.vimkana.vimlithuanian-baltic.vimmagyar_utf-8.vimpersian-iranian_utf-8.vimpersian.vimpinyin.vimpolish-slash.vimpolish-slash_cp1250.vimpolish-slash_cp852.vimpolish-slash_iso-8859-2.vimpolish-slash_utf-8.vimrussian-jcuken.vimrussian-jcukenwin.vimrussian-yawerty.vimserbian-latin.vimserbian-latin_utf-8.vi&lP0@00HJ`?I#d	%	`	BHOt[[	[
L[[[
\[[[V[ `=(89:z>)s@){F)G)[H+[I,|[X-xY-\-[]/[^7UbBdB"eB'fB,kB.lB5tBP[uC[vE(wE[xGX[yH{H[I4I8IHAIA
III[JTgJXhJ\Csystem-config-kdump1.0.145.el5_9A graphical interface for configuring kernel crash dumpingsystem-config-kdump is a graphical tool for configuring kernel crash
dumping via kdump and kexec.Qκbuilder10.centos.orgӡCentOS-5CentOSGPL2+System Environment/Basehttp://fedora.redhat.com/projects/config-tools/linuxnoarchtouch --no-create /usr/share/icons/hicolor
if [ -x /usr/bin/gtk-update-icon-cache ]; then
  gtk-update-icon-cache -q /usr/share/icons/hicolor
fitouch --no-create /usr/share/icons/hicolor
if [ -x /usr/bin/gtk-update-icon-cache ]; then
  gtk-update-icon-cache -q /usr/share/icons/hicolor
fiaR
FCeooo%4oo%!$ooooooY.o#o%
Dpoo&o&ooo!P)#roWooo'f	o+	o$$KoooooJZ],],A큤AA큤큤QΥQΥQΥQΦQΦEB6G\QΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΥQΦQΦQΦQΦQΦQΦQΥQΥQΥQΥQΥQΦQΦf5be82be51135cf46de5955695f67c0dd524f0729309195c8cc909603b5b0db02be27190c74e96f7b21510477ff1452d751419260aa954499f7abaabaa882bbef4ebf444567c5ad04c5d2cbbf87533b0639b1a00c1ba9c4b243e976b9f7563893c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b69792d435096b9397a572fdc1ee6737f3c287e745737db078a1fc8c54c748c4b39c8aa3a06ff451601f839ec5b3ddba53c287e745737db078a1fc8c54c748c4b3b2e8804f64ec00598671c0a08e6925a3f52b2811389ca4fd5b0aae7fc6155f49df873f52c75847931a29835e6c25dd23fc14fe939df7cfb9240ed33f08b30a03c287e745737db078a1fc8c54c748c4b292d7e290095c30e1a87ff761fa91fd73e9fddafed5a14ee2904c072c307b0453c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b69e44fd5537f04a650592314e3eec1213c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4b02c988c85ff417b0c9ae8537b0dc74f0e91e5f76be0012326397127f201350f23c287e745737db078a1fc8c54c748c4be37f5c24731da4fd3e8bb2754c34a4fc3c287e745737db078a1fc8c54c748c4bb87d5e1d095061e8ebd0006c0716c66c489348c195f79ad675eeae5d357bd3b57d457a8cc3fd0acf43887582fde9ee213c287e745737db078a1fc8c54c748c4b3c287e745737db078a1fc8c54c748c4bj 0^3@342 IO when port/session is changing (mchristi@redhat.com ) [498281]
- [net] igbvf: new driver, support 82576 virtual functions (Andy Gospodarek ) [480524]
- [net] ehea: fix circular locking problem (AMEET M. PARANJAPE ) [493359]
- [s390] appldata: vtimer bug with cpu hotplug (Hans-Joachim Picht ) [497207]- Revert: [mm] fork vs fast gup race fix (Andrea Arcangeli ) [471613]- Revert: [scsi] marvell sas: initial patch submission (Rob Evers ) [485126]
- Revert: [scsi] marvell sas: correct bit-map implementation (Rob Evers ) [485126]
- Revert: [scsi] marvell sas: comment cleanup (Rob Evers ) [485126]
- [misc] FIPS: create checksum for verification at bootup (Don Zickus ) [444632]
- [md] dm: raid45 target oops on mapping table reload (Heinz Mauelshagen ) [500387]
- [md] dm: raid45 target doesn't create parity as expected (Heinz Mauelshagen ) [499406]
- [net] igb: correctly free multiqueue netdevs (Andy Gospodarek ) [500446]
- [misc] lockdep: fix large lock subgraph traversal (Aristeu Rozanski ) [462248]
- [crypto] make tcrypt stay loaded on success (Jarod Wilson ) [499646]
- [crypto] block use of non-fips algs in fips mode (Jarod Wilson ) [499646]
- [crypto] mark algs allowed in fips mode (Jarod Wilson ) [499646]
- [x86_64] 32-bit ptrace emulation mishandles 6th arg (Jiri Olsa ) [495125]
- [fs] cifs: buffer overruns when converting strings (Jeff Layton ) [496577]
- [scsi] lpfc: update from version 8.2.0.41 to 8.2.0.43 (Rob Evers ) [498524]
- [cpufreq] xen: powernow identifies wrong number of procs (Miroslav Rezanina ) [456437]
- [scsi] MPT fusion: remove annoying debug message v2 (Tomas Henzl ) [475455]
- [scsi] MPT fusion: make driver legacy I/O port free v2 (Tomas Henzl ) [475451]
- [scsi] MPT fusion: update version 3.04.07rh v2 (Tomas Henzl ) [475455]
- [ia64] fix regression in nanosleep syscall (Prarit Bhargava ) [499289]
- [md] s390: I/O stall when performing random CHPID off/on (Mikulas Patocka ) [500729]
- [crypto] add hmac and hmac(sha512) test vectors (Jarod Wilson ) [499463]
- [sched] accurate task runtime accounting (Peter Zijlstra ) [297731] {CVE-2007-3719}
- [sched] rq clock (Peter Zijlstra ) [297731] {CVE-2007-3719}
- [x86] scale cyc_2_nsec according to CPU frequency (Peter Zijlstra ) [297731] {CVE-2007-3719}
- [i386] untangle xtime_lock vs update_process_times (Peter Zijlstra ) [297731] {CVE-2007-3719}
- [x86_64] clean up time.c (Peter Zijlstra ) [297731] {CVE-2007-3719}
- [net] tun: add packet accounting (Herbert Xu ) [495863]
- [kabi] add pcie_set_readrq (Jon Masters ) [479200]
- [kabi] add Kernel Virtual Machine kABI symbols (Jon Masters ) [466961]
- [crypto] add ctr test vectors (Jarod Wilson ) [497888]
- [crypto] print self-test success notices in fips mode (Jarod Wilson ) [497885]
- [mm] fork vs fast gup race fix (Andrea Arcangeli ) [471613]
- [mm] support for lockless get_user_pages (aarcange@redhat.com ) [474913]
- Revert: [mm] fork vs gup race fix (aarcange@redhat.com ) [471613]
- [net] r8169: reset IntrStatus after chip reset (Ivan Vecera ) [500740]
- Revert: [net] forcedeth: power down phy when IF is down (Ivan Vecera ) [479740]
- [misc] add AMD IOMMU support to KVM (Bhavna Sarathy ) [481026]
- [misc] VT-d: backport of Intel VT-d support to RHEL5 (Don Dutile ) [480411]
- [misc] VT-d: add clflush_cache_range function (Don Dutile ) [480411]
- [misc] VT-d: add DMAR-related timeout definition (Don Dutile ) [480411]
- [misc] VT-d: add DMAR ACPI table support (Don Dutile ) [480411]
- [misc] VT-d: add pci_find_upstream_pcie_bridge (Don Dutile ) [480411]
- [misc] VT-d: move common MSI defines to msi.h (Don Dutile ) [480411]
- [trace] blk tracepoints (Arnaldo Carvalho de Melo ) [493454]
- [pci] enable CONFIG_PCI_IOV (ddugger@redhat.com ) [493152]
- [pci] save and restore PCIe 2.0 registers (ddugger@redhat.com ) [493152]
- [pci] restore PCI-E capability registers after PM event (ddugger@redhat.com ) [493152]
- [pci] add SR-IOV API for Physical Function driver (ddugger@redhat.com ) [493152]
- [pci] centralize device setup code (ddugger@redhat.com ) [493152]
- [pci] reserve bus range fork;	W@WXCCCCCCCCCCCCCCCCCCCCCCCCC"csdadeeseufifrglhuidisitjakonbplptptroruskslsrsvtrukwazhzhzh1.10.2.3-36.el5_11	

 !"popt.hlibpopt.alibpopt.solibpopt.so.0libpopt.so.0.0.0popt-1.10.2.3CHANGESCOPYINGREADMEpopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.mopopt.3.gz/usr/include//usr/lib//usr/share/doc//usr/share/doc/popt-1.10.2.3//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/eu_ES/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/wa/LC_MESSAGES//usr/share/locale/zh/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnuASCII C program textASCII English textELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), strippedcurrent ar archivedirectorysymbolic link to `libpopt.so.0.0.0'	RRPRRRRRRRR
?`1#a$7P|?TXGV(^E)ߕt7	O
?}D1?TXGV(2LmB4ve21QС&L;-ב#7"f06729af69cf5a7c142f89f4ac4c838bf57001a83\=
<\<ck sizes (#74073)
- tzdata update- update from CVS
  - handle low stack limits
  - move s390x into */lib64- update to 2.3 final
  - fix freopen on libstdc++ <= 2.96 stdin/stdout/stderr (#74800)- don't prelink -r libc.so on ppc/x86-64/sparc*, it doesn't
  speed things up, because they are neither REL arches, nor
  ELF_MACHINE_REL_RELATIVE
- fix sparc64 build- update from CVS- update from CVS
- prelink on ppc and x86-64 too
- don't remove ppc memset
- instead of listing on which arches to remove glibc-compat
  list where it should stay- fix wcsmbs functions with invalid character sets (or malloc
  failures)
- make sure __ctype_b etc. compat vars are updated even if
  they are copy relocs in the main program- fix /lib/libnss1_dns.so.1 (missing __set_h_errno definition
  leading to unresolved __set_h_errno symbol)- security fix - inekd !t@tus
zshskel.zshrczloginzlogoutzprofilezshenvzshrczsh4.2.6zshcap.soclone.socompctl.socomplete.socomplist.socomputil.sodatetime.sodeltochar.soexample.sofiles.solanginfo.somapfile.somathfunc.sonetsocket.sotcp.soparameter.sorlimits.sosched.sostat.sosystem.sotermcap.sozftp.sozle.sozleparameter.sozprof.sozpty.sozselect.sozutil.sozsh-4.2.6BUGSCONTRIBUTORSFAQFEATURESLICENCEMACHINESNEWSREADMEcompletion-style-guidezsh-development-guidezshprompt.plzsh.info-1.gzzsh.info-2.gzzsh.info-3.gzzsh.info-4.gzzsh.info.gzzsh.1.gzzshall.1.gzzshbuiltins.1.gzzshcompctl.1.gzzshcompsys.1.gzzshcompwid.1.gzzshcontrib.1.gzzshexpn.1.gzzshmisc.1.gzzshmodules.1.gzzshoptions.1.gzzshparam.1.gzzshtcpsys.1.gzzshzftpsys.1.gzzshzle.1.gzzsh4.2.6functions_a2ps_aap_acroread_alias_aliases_all_labels_all_matches_alternative_ant_antiword_apachectl_apm_approximate_apt_apt-move_apt-show-versions_aptitude_arch_archives_arch_namespace_arg_compile_arguments_arp_arping_arrays_assign_attr_auto-apt_autocd_bash_completions_baz_bindkey_bison_bittorrent_bogofilter_brace_parameter_bsd_pkg_bts_bug_builtin_bzip2_bzr_cache_invalid_cal_call_function_call_program_cd_cdcd_cdrecord_chflags_chkconfig_chmod_chown_combination_command_command_names_compdef_complete_complete_debug_complete_help_complete_tag_compress_condition_configure_correct_correct_filename_correct_word_cpio_cplay_cvs_cvsup_cygcheck_cygpath_cygrunsrv_cygserver_cygstart_darcs_date_dchroot_dcop_dd_deb_packages_debchange_debfoster_debsign_default_defaults_describe_description_dict_dict_words_diff_diff_options_dir_list_directories_directory_stack_dirs_disable_dispatch_dlocate_domains_dpkg_dpkg-cross_dpkg_source_dput_du_dumper_dupload_dvi_ecasound_echotc_echoti_elinks_elm_email_addresses_emulate_enable_enscript_equal_expand_expand_alias_expand_word_fakeroot_fc_fetchmail_figlet_file_descriptors_file_systems_files_find_finger_fink_first_flex_floppy_fsh_functions_gcc_gdb_generic_getclip_getconf_getent_getfacl_git_global_global_tags_gnome-gv_gnu_generic_gpg_gphoto2_gprof_gqview_grep_groups_gs_guard_gv_gzip_hash_hdiutil_history_history_complete_word_hosts_iconv_ifconfig_ignored_imagemagick_in_vared_init_d_iptables_irssi_ispell_java_java_class_jobs_jobs_bg_jobs_builtin_jobs_fg_joe_kfmclient_kill_killall_kld_last_less_limit_limits_links_lintian_list_loadkeys_locales_logical_volumes_look_losetup_lp_ls_lscfg_lsdev_lslv_lAjX'	e@efdas) [959532]
- [fs] extN: tighten restrictions on inode flags (Eric Sandeen) [756309]
- [mm] use-after-free in madvise_remove() (Jacob Tanenbaum) [849736] {CVE-2012-3511}
- [internal] kernel.spec: add Provides line to kernel-debug-devel (Phillip Lougher) [709658]- [fs] ext4: Avoid crashing on NULL ptr dereference on fs error (Carlos Maiolino) [867748]
- [fs] ext4: set extents flag when migrating file to use extents (Carlos Maiolino) [867748]
- [fs] ext4: Convert more i_flags references to use accessors (Carlos Maiolino) [867748]
- [fs] ext4: Fix remaining racy updates of EXT4_I(inode)->i_flags (Carlos Maiolino) [867748]
- [fs] ext4: Use bitops to read/modify i_flags in ext4_inode_info (Carlos Maiolino) [867748]
- [fs] ext3/4: don't clear orphan list on ro mount with errors (Eric Sandeen) [850803]
- [fs] jbd2: round commit timer up to avoid uncommitted transaction (Carlos Maiolino) [892393]
- [scsi] ibmvfc: Ignore fabric RSCNs when link is dead (Steve Best) [964334]
- [mm] Page migration: Don't accept invalid nodes in target nodeset (Jan Stancek) [848473]
- [mm] Break out when there is nothing more to write for the fs. (Larry Woodman) [965359]
- [sound] ALSA - fix the no-sound issue for Creative Recon3D cards (Jaroslav Kysela) [796912]- [fs] zisofs: fix readpage() outside i_size (Eric Sandeen) [952860]
- [net] fixed: fix module unloading for the 'fixed' driver (Nikolay Aleksandrov) [647894]
- [net] ipv6: assign rt6_info to inet6_ifaddr in init_loopback (Jiri Benc) [971067]
- [net] Bluetooth: fix possible info leak in bt_sock_recvmsg() (Radomir Vrbovsky) [955601] {CVE-2013-3224}
- [block] gen8plus Smart Array IDs (Linda Knippers) [919633]
- [net] Bluetooth: HCI & L2CAP information leaks (Jacob Tanenbaum) [922416] {CVE-2012-6544}
- [virt] xen PV passthru: assign SR-IOV VFs to sep virtual slots (Laszlo Ersek) [865736]
- [scsi] be2iscsi: This patch bumps the version number (Rob Evers) [962503]
- [scsi] be2iscsi: This patch fixes the NOPIN issues (Rob Evers) [962503]
- [xen] cap physmem at 1TB (Andrew Jones) [961667]
- [xen] cleanup invalid checksum error (Andrew Jones) [914814]
- [xen] mask cpuid avx (Andrew Jones) [894360]- [fs] autofs4: use __simple_empty() for empty directory check (Ian Kent) [873922]
- [fs] autofs: remove autofs dentry mount check (Ian Kent) [928098]
- [redhat] kabi: Adding symbol register_lro_netdev (Jiri Olsa) [873514]
- [redhat] kabi: Adding symbol unregister_lro_netdev (Jiri Olsa) [873514]
- [misc] signal: use __ARCH_HAS_SA_RESTORER instead of SA_RESTORER (Nikola Pajkovsky) [920504] {CVE-2013-0914}
- [misc] signal: always clear sa_restorer on execve (Nikola Pajkovsky) [920504] {CVE-2013-0914}
- [misc] signal: Def __ARCH_HAS_SA_RESTORER for sa_restorer clear (Nikola Pajkovsky) [920504] {CVE-2013-0914}
- [net] ipv6: Fix broken IPv6 routing table after loopback down-up (Jiri Benc) [745321]
- [virt] hv: use gracefully shutdown instead of poweroff (Jason Wang) [903460]
- [md] dm kcopyd throttling (Mikulas Patocka) [958556]
- [scsi] storvsc: Properly handle in-transit packets during a reset (Jason Wang) [865292]
- [net] sky2: fix scheduling while atomic in sky2_vlan_rx_register (Nikolay Aleksandrov) [920757]
- [x86] fix timeout of poll(2) w/ 32-bit processes on x86_64 (Naoya Horiguchi) [794670]- [net] tg3: buffer overflow in VPD firmware parsing (Jacob Tanenbaum) [949940] {CVE-2013-1929}
- [net] atm: update msg_namelen in vcc_recvmsg() (Nikola Pajkovsky) [955223] {CVE-2013-3222}
- [ia64] fix KABI breakage on ia64 (Prarit Bhargava) [960783]
- [cpufreq] acpi-cpufreq more defensive against BIOS freq changes (Lenny Szubowicz) [921856]
- [net] tcp: connect() race with timewait reuse (Jiri Pirko) [947038]
- [block] ide: Allow configuration of prefer_ms_hyperv (Radomir Vrbovsky) [907231]
- [infiniband] Return link layer type to userspace query port op (Jay Fenlason) [866331]
- [scsi] ipr: Fix oops while resetting an ipr adapter (Steve Best) [914391]
- [net] ipv6: Remove IPV6_ADDR_RESERVED (Amerigo Wang) [728922]
- [net] IP_MULTICAST_IF setsockopt now recognizes struct mreq (Jiri PirkoSk	@"behaviors (#42111)- add xinetd configuration- 2.4.6- update to 2.4.4 - fixes yet another problem with rsh transport- automatic rebuild- rebuild in new build env.- update to 2.4.3- update to 2.4.2- fix maxdelete behavior so it isn't sent to older servers.- update to 2.4.1.- update to 2.3.2- add "max. delete" patch to limit damage when server is hosed.- update to 2.3.1.- auto rebuild in the new build environment (release 2)- update to 2.3.0.- update to 2.3.0 beta.- update to 2.2.1- updated to 2.1.1- updated to 2.1.0- buildrooted and attr-rophied
- removed tech-report.ps; the .tex should be good enough- Built 1.6.3-2 after finding no rsync-1.6.3-1.src.rpm although there
  was an ftp://ftp.redhat.com/pub/contrib/alpha/rsync-1.6.3-1.alpha.rpm
  showing no packager nor signature but giving 
  "Source RPM: rsync-1.6.3-1.src.rpm".
- Changes from 1.6.2-1 packaging: added '$RPM_OPT_FLAGS' to make, strip
  to '%build
LANG=C
export LANG
unset DISPLAY
', removed '%prefix'.- rsync-1.6.2-1 packaged.  (This entry by jam to credit Michael for the
  previous package(s).)builder17.centos.org 14133659616668696:6;6<6=6E6I6K6>6B6F6C6?6G6@6A6H6J6D6L6763.0.6-6.el5_113.0.6-6.el5_11rsyncrsyncrsync-3.0.6COPYINGNEWSOLDNEWSREADMEsupportMakefileatomic-rsynccvs2includesdeny-rsyncfile-attr-restorefiles-to-excludesgit-set-file-timeslogfilterlshmnt-exclmunge-symlinksrrsyncrsyncstatssavetransfer.ctech_report.texrsync.1.gzrsyncd.conf.5.gz/etc/xinetd.d//usr/bin//usr/share/doc//usr/share/doc/rsync-3.0.6//usr/share/doc/rsync-3.0.6/support//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII C program textASCII English textASCII make commands textBourne shell script text executableBourne-Again shell script text executableELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippeddirectoryperl script text executable	RRRRRRRRR?`j9\~cmȫ?T>d!GV(FK6S5}'(Tgį)qr(z1R?T>d!GV(zj/W)~|ʍ\tptte؄?x]%"g~e14c8bb3aad36ab3c3d7260ac39be1bb02302bd8\<
s\<redhat.com> 2.1.30-1Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.30-0Thomas Woerner <twoerner@redhat.com> 2.1.29-3Nalin Dahyabhai <nalin@redhat.com> 2.1.29-2Nalin Dahyabhai <nalin@redhat.com> 2.1.29-1Nalin Dahyabhai <nalin@redhat.com> 2.1.29-0Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com> 2.1.25-5.1Tim Waugh <twaugh@redhat.com> 2.1.25-5Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.25-4Nalin Dahyabhai <nalin@redhat.com> 2.1.25-3Nalin Dahyabhai <nalin@redhat.com> 2.1.25-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.25-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@jbj.org> 2.1.22-9Nalin Dahyabhai <nalin@redhat.com> 2.1.22-8Nalin Dahyabhai <nalin@redhat.com> 2.1.22-7Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@jbj.org> 2.1.22-6.1Nalin Dahyabhai <nalin@redhat.com> 2.1.22-6Nalin Dahyabhai <n)lPI0@000













"
%
(
+
.
1
4
7
:
=
@
C
F
I
L
O
R
U
X
[
^
a
d
g
j
m
p
s
v
y
|


























afamarasbebgbnbnbscacscydadeeleneseteufafifrglguhehihrhuhyidisitjakaknkokuloltlvmaimkmlmrmsmynbnlnnnonsoorpaplptptrorusiskslsqsrsr@latinsvtatethtrukurvizhzhzu1.0.14-5.el5_91.0.14-5.el5_9	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTSSSSSsystem-config-kdumpsystem-config-kdumpsystem-config-kdumpsystem-config-kdump.desktopsystem-config-kdump-1.0.14COPYINGChangeLogsystem-config-kdump.pngsystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdump.mosystem-config-kdumppixmapssystem-config-kdump.pngsystem-config-kdumpsystem-config-kdump.gladesystem-config-kdump.pysystem-config-kdump.pycsystem-config-kdump.pyo/etc/pam.d//etc/security/console.apps//usr/bin//usr/share/applications//usr/share/doc//usr/share/doc/system-config-kdump-1.0.14//usr/share/icons/hicolor/48x48/apps//usr/share/locale/af/LC_MESSAGES//usr/share/locale/am/LC_MESSAGES//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/as/LC_MESSAGES//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/bs/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cy/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu_ES/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSA#kh@`3a3b3c3d3e3f3g3h3i3j3k3l3m3n3o3p3q3r3s3t3u3v3w3x3y3z3{3|3}3~3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333	3
333
33333333333333334%4G4H4I4J4K4L4M4N4O4P4Q4R4S4T4U4V4W4X4Y4Z3_3P3Q3R3S444443Y3Z3[43]3^43`4443d3e43g3h43j43l3m3n3o3p3q3frfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfrfritititititititititititititititititititititititititititititititititplplplplplplplplplplplplplplplplplplplplplplplplplplplplplplplplplrurururururururururururururururururururururuafafafcacacacscscsdededeen_GBen_GBen_GBesesesfrfrfrgagagaitititjajajakokokonononoplplplrururusksksksvsvsvukukukvivivizh_CNzh_CN.UTF-8zh_CN.UTF-8zh_CN.UTF-8zh_CNzh_CNzh_TWzh_TW.UTF-8zh_TW.UTF-8zh_TW.UTF-8zh_TWzh_TW2:7.0.109-7.2.el52:7.0.109-7.2.el5	









            !!!!!!!!!!!!!!!!!!""""""""""""""""""""""""""""""""""""""""""""##################################]k`X!@R76b055b66277bb2bb629c230f0789591fb81c2089d627a7fbde85c6dbfa7fe80bdb2707ba855b9198f00e1e2f395f7bf6a807d726b7a6bbb3fc46c67deca31bf10366694d8721bf7525dae2a3ac9e75143767ff86301af73aba90fece868682e1e9ece139f9123343e436164eaa7295ad23d19c3a4c0423c4fa34d2441bb542079226f05da5b5fc81fae2a70626b6086134f3c95cca90ff6855b686e405d3fed349dbf55b1b4b344591df8a3eed3cdb6d10bf00423fac85959cbd6377b8a9f2bfee988e2a9e64d43218048bb1c0bb27fb72cdb3183d3a6a3367bc92db299b3bdc31db0e9a7e7a9a8e6426be9e133165e8a776c70a5f19c4ebde511ce6d786f6b12c05f3a36b800d9d8b2c44015b22bc2ee0dd187f1938977537ea3e32af65f6e748cb97de4bfc505bdd4b59e0d38a90b8c073b8917550e11e9d7a3311255c6e5cbfd9a3af9da48f916c5e8af0915715b663b8e53fd538f0b160e3a18b7eb8e85f23184b72bcc9ad1ed95381fcac36bd156e570b630311e04f1a98240a35f3531e2aa50c31121c1a517713ddefc91e6ce3264103adce3d0842245f97908ffe3f91d736ae8da0f86e7e21578005c9506aee8344259c75f2478174f073429efc6f2d845a0cc47a62c5e725661bce80efdc75962dae5974cadb052d7c48391d0c1f42686c3b8c88b8c898822efc7859d716884c07d24777a3c8f4a2d01b116918a36eb7c15e8ca34b6104f58f6f13fdc593c44391f14a9f4938ef54645a6edf6c16a477697285d3a8cfc8e8c1a2575a191e5df33dccde02ae5029b36721d87eac1d9cd692e595a5f3c6fd53f6ff876008744b9e4380d22a7021efc1e4e6de2bf9fa3f93667cc890ce5a73ec6ca3b234605ee00a468250329ff4be94f1a81308a1543fb55e8233e92698bf9552b4110a45937f92191aacccd565697a439da977cb49519bbdbc08e1d865b0ed12e79e41b83af248c5c736a6cdf2d7d7a539667175570b7286cf198f19a7c08fbdd470d452dfaa14f13bceb01d1e48c51d4b2b642521798488aa2a4d9b64ca8921384e6baafc47307f329e4d0703590db5fbdc8b941579599003c77b39dac1a72bfd45d09266f1a1f27476ef2d6ce1331bcbbd1137b9d8ff951c1bb4f2ce31e02f53098b92ba40804a7a97c48d7b6e5e26f4e462d5942715aeb73ec7758e9eda1afcb6d9cd46d658aebb444e453fa0efc3430fb40f97234f79b6ac6e3fc3cbb0b124a54fdffd93256b358e931c3d7023ffc6f61bac47445dec3658db41755cb8868570cd648b28d8a4dca2f952f6d8c13f55f0808f42829bdf5bdd09cf8d07e9077fa99a0f2c7bba6b086f741b3ee67735bd386fc5e802f057a1ef598736780b405307dee102441788e160344e2a7a231e3d8fbda2c1bd014cea87e94087944492ad50cc26ee7f956b7a60dd3647479f989a5a8254ba9050e29a772aa3278dbf4f2e0db290c4328e9842f48e6f0ee9c6485bb6fe54ecac5d49f3f755cf047a9f4661c4f583a2dc48a785ed1e92e1f4735985ed18432490f64222a47c5fc88b7ba4e61efa16058bb50c6f83a0935c1a429fb7e3b270dcca09ef7b95e35abee73eac29f8k ,,@,,DZP?Y@d		N $<@IP	s0l0	0
,00
|0

000

0lx!!!(
8y9y:)yFNGN0HOl0IP,0XP\YP`\Pt0]Q40^RbSPdSeSfSkSlStS0uT0vUt
wV0xW0yXH2{Y0YPYTYdAYA
YZZ0ZDgZHhZLCrpm-devel4.4.2.336.el5_11Development files for manipulating RPM packagesThis package contains the RPM C library and header files. These
development files will simplify the process of writing programs that
manipulate RPM packages and databases. These files are intended to
simplify the process of creating graphical package managers or any
other tools that need an intimate knowledge of RPM packages in order
to function.

This package should be installed if you want to develop programs that
will manipulate RPM packages and databases.TVrbuilder17.centos.orgACentOS-5CentOSGPLv2+ and LGPLv2+ with exceptionsDevelopment/Librarieshttp://www.rpm.org/linuxx86_64/
Df3,Q,DPf()/1=B(
B&	wė		O:Q}2Y>

Px tcA큤큤TVoTVcTV_TV_TVaTV_TVaTVaTVbTVbTVcTVbTV_TVaTVbTV_TVcTVbTVcTVbTVaTV_TVbTV_TV_TV_TV_TVbTVcTV_TV_TVbTVbTVbTV_TVbTV_TVpTVoTVcTVoTVdTVoTVbTVoTV_TVgTVg18013bf8b5038cc93b424b9324c26c49b6e28abc7fc0375fe8a02b2608751c4543e5b952d9f3e8ebfef4d8534e02eb2ff9f26372dae195706dabe037608a01b4926d46e04acb763ac3628f70a7b9fb032257330f56c43f243c37fa9f0eae18f4fbf982a6b4b43c1b1a2d7190e8fd964b33a6f248d3e4111e9462735ba172520a033ea49fc40c0f7490a815e0a78b27ad3012c24fb1e4bef25bd68ffd3c7315f9c01aae905aaddca88eb2725e7a7c5aba696b738e78c93bef7ecf4e3bb2557ceb2a452e6345f324129fcf29aa532b543dafcedb900c3898d25214287c2d503177b1b6c070adb1986106d723513283eaf073e683da220f44eae0772bb3e85c5a53e19c8cfc4a4568644396d26f92223b547a1fdeb133b75f5760f40026ff3f6f4042ea74a91add11322c5d80431724a73fb1a2e88be40d2122d16249b1cef2a5ca25e8a2a8b3703819dfb92355760f37deb4577fa17624c95ea53728b53a465e0d9c136ede425f8296e4131f2370da3120935ab0bfc2a81374a5b850145dae1b964552d93ed0c4c1d37dadfe48dd1822cd4f46365a57a2ab7bd47c07862c241b0ee0c3f9f95c89f7ab107379d2c5915a077ba3c47472cb528c4302a196839bae9b91df1d13f960a59c618bac9304efcd553336b25ad10e125d9a1ee144f9713b4a3512b4d905a99843a937f3e8aae891a569e0d892f3dc5e82d2f47cf3f3bb63585c430666aa96f89a0a5920a112f31365f09362d4c0581f1cd21766600b616719a830432442e5728843ec8b9f2ddfdf0e59789f20beb6b283814969f683730acb59eab54f52fd0bc9976d44bd8e9ff9f2ebadc63b6716e4cd107a7b27f6baba07b98b09d98132eb4f43fb66923a12ac1e6bc542e157db1e1661282a60a6238175e4c198d090e5768318090609fa01c543af42970c7fb756f2278dfa3a2718bee2d37f5f1ca8f8bb6690975134b81d6addlibrpm-4.4.solibrpmbuild-4.4.solibrpmdb-4.4.solibrpmio-4.4.soQk@a <jkaluza@redhat.com> - 3.0.6-5Jan Kaluza <jkaluza@redhat.com> - 3.0.6-4Vojtech Vitek <vvitek@redhat.com> - 3.0.6-3Vojtech Vitek (V-Teq) <vvitek@redhat.com> - 3.0.6-2Vojtech Vitek (V-Teq) <vvitek@redhat.com> - 3.0.6-1Jesse Keating <jkeating@redhat.com> - 2.6.8-3.1Jay Fenlason <fenlason@redhat.com> 2.6.8-3Jay Fenlason <fenlason@redhat.com> 2.6.8-2Jesse Keating <jkeating@redhat.com> - 2.6.6-2.2.1Jesse Keating <jkeating@redhat.com> - 2.6.6-2.2Jesse Keating <jkeating@redhat.com>Jay Fenlason <fenlason@redhat.com> 2.6.6-2Jay Fenlason <fenlason@redhat.com> 2.6.5-2Jay Fenlason <fenlason@redhat.com> 2.6.5-0.pre1.0Jay Fenlason <fenlason@redhat.com> 2.6.4-3Jay Fenlason <fenlason@redhat.com> 2.6.4-2Jay Fenlason <fenlason@redhat.com> 2.6.3-3Jay Fenlason <fenlason@redhat.com> 2.6.3-2Jay Fenlason <fenlason@redhat.com> 2.6.3-1Jay Fenlason <fenlason@redhat.com> 2.6.3-0.pre2Jay Fenlason <fenlason@redhat.com> 2.6.3-0.pre1Elliot Lee <sopwith@redhat.com>Mark McLoughlin <markmc@redhat.com> - 2.6.2-1Jay Fenlason <fenlason@redhat.com> 2.6.2-0Jay Fenlason <fenlason@redhat.com> 2.6.1-1Jay Fenlason <fenlason@redhat.com> 2.6.1-0.pre1Elliot Lee <sopwith@redhat.com>Jay Fenlason <fenlason@redhat.com> 2.6.0-0Bill Nottingham <notting@redhat.com> 2.5.7-2Bill Nottingham <notting@redhat.com> 2.5.7-1Hardy Merrill <hmerrill@redhat.com> 2.5.6-20Lon Hohberger <lhh@redhat.com> 2.5.6-19Hardy Merrill <hmerrill@redhat.com> 2.5.6-18Hardy Merrill <hmerrill@redhat.com> 2.5.6-17Hardy Merrill <hmerrill@redhat.com> 2.5.6-16Hardy Merrill <hmerrill@redhat.com> 2.5.6-15Hardy Merrill <hmerrill@redhat.com> 2.5.6-14Hardy Merrill <hmerrill@redhat.com> 2.5.6-13Hardy Merrill <hmerrill@redhat.com> 2.5.6-12Hardy Merrill <hmerrill@redhat.com> 2.5.6-11Hardy Merrill <hmerrill@redhat.com> 2.5.6-10_CVSHEAD_signpatchHardy Merrill <hmerrill@redhat.com> 2.5.6-9_CVSHEAD_nopatchesHardy Merrill <hmerrill@redhat.com> 2.5.6-8Hardy Merrill <hmerrill@redhat.com> 2.5.6-7Hardy Merrill <hmerrill@redhat.com> 2.5.6-6Elliot Lee <sopwith@redhat.com>Hardy Merrill <hmerrill@redhat.com> 2.5.6-4Hardy Merrill <hmerrill@redhat.com> 2.5.6-3Hardy Merrill <hmerrill@redhat.com> 2.5.6-2Hardy Merrill <hmerrill@redhat.com> 2.5.6-1Tim Powers <timp@redhat.com>Hardy Merrill <hmerrill@redhat.com> 2.5.5-3Tim Powers <timp@redhat.com> 2.5.5-2Bill Nottingham <notting@redhat.com> 2.5.5-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bill Nottingham <notting@redhat.com> 2.5.4-2Bill Nottingham <notting@redhat.com> 2.5.4-1Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkraenzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>John A. Martin <jam@jamux.com>Michael De La Rue <miked@ed.ac.uk>- Resolves: #1107941 - error while removing extended attributes- fix #724041 - fixed free-hostnames patch- fix #700450 - free parsed hostnames
- fix #575022 - set TZ variable after chroot- Add upstream patch to fix CVE-2011-1097 - Incremental file-list
  corruption due to temporary file_extra_cnt increments
  Resolves: #688923- Remove BuildRequires dependency on popt-devel, until the package
  is being shipped with RHEL-5 (resolve build issues)- Rebase to upstream version 3.0.6
  Resolves: #339971, #471182, #575022, #616093
- Make "-d, --dirs optiok+-@+-*-,-db5ff943687aa5b4ba89519798b8a44aa39500f6aa6eb489d51d32762ced25fa84521bf927a35daa628131f335368433f6f1220ee21e236ec4e1d714b54ddfef59b1585dfa0c3a2a3707006f5276fa7171b8e8d4757af47ad78b1b43e20d215ceb30c9c7038d7d3ff182a190b03ea5175d61180be275463a033276f441ad6649c4bc1cf47db3c271c6473b3ebd7e6d206d73850d77d305ab548f9572f07d9272deb4ae870ca6821117877fab1d0a24cd2060259fc0d3dd29024db86254f4ce0f860caf15a7630d500670ad349c2fe7eaaadaabf7a1e11686c05c020e178e2a0f8600d768350384aecfb9a357b77627ea524c095934962f5dee442cb56953f6ccdc0a5aa35cf871d2d4f6d6b6e4a5d080acd01cffdf95f02fc6752d5ff04cfb3722642ae020e4cb09816777b458c7b597e7ce5a59c8f4243468ad66cdd0216f442bf6845c103aba1b4bcb8691bbaf33b982018a1b2ba60d89fdcb2a3e92b022a99a76d6fceeb35576bb7718ff10610a92f24c3f0fc35078f5764867e679ecac07495041b92e24ba98f6622c7e4e1d817499b630d63ab40f95a64828051b23839855ffbb232c8ba2211a4d9ca6fa0d1a793a7d794967c497dc9112077c263a905499b8177ee93b6ab39b262669f3342db337c1a28df32d4b85eba94be69164a2345a37ac0b1001f2084ee5abc4b58ea573ee05ceb46cac6c3eeef8211a84665f786e99169afa8e9dceb5003cad49dfaba969e5b9161748d98b6f8eb0b0433fb6f377e50662e0f89b1e2f8e49ad2b5e466f1613a0a281969296efe652eaf7d8b5f8bf6e7c6949c5f1b260289ef08161b16d07d12969e2ff0db52c0006da39259d226409f45e234b8e4f0ae1e9f4d622cd5afe28d58e8808651c896ff1ec3d0264c72c908e119c22c7787892db947bfaa87452e5e5d3436b232d96b1cf7066052f4864add31dffd8fc4bb1b9b7f6f7573d4bb6bf0f55ed9ebd79f3f786f0f67842b8cc059137a88288e95115a1829fd9e419eee2efa4ef6ce493ca51a9c782f998bab59d0221977c1c0eaa676c835dcf1dd29a802080c984e52d76e5b1f3d412b47729eb73afc7aa430feeb7da0489005941fbb522369466ca850189c59f64cfcfac0c4219edebc96d6d043c84c0def94f52c5e45256232320aaffeb1ce2f899cf0909049b0472654d7357eaeb35ba16a0731d050493bd7e0b95244aafc2245032ab69fc481e2eefd246aa96e071b1da3ec69df05af5f2a5475e8a8a24b700644702db92b31d7488edfb3adfe7eca20b7b781cf82d1aeb36ce63590ccd0c4ec8d7f81407ce09d175d7366c25ba0109e4af9c43357a74c6de01db819f36f2188e42454c65ed8a37126d0f5f5830adbb88aaf05b4a6a7df59c72cc5c947b4a9dfccc01739501bbc01d561da12c94472baddf4a76d4d74f634edf1e71134b3ee8d311bafbc474875730d7644e86047ddf37bee4d12f626b42004e26bdd4e1359c28f6840b1f20094af4ffc16ce3189ba57721ff902105ef3c79eb199f4da5e268f90fc598ccf5a5bd1de7d1f57c873b91e86a449cb257dd92ada947c2b2320af83032a68f54f420f04430efd7629c85508972bd6f704cddb4b4faeaa5397b0a9718d128b1abbf9710cb7ea315cffecc3df2af08328cd4cbf697d55ca9cd4192f9c98d5610fc9a8f02c7312c3c4969112df01000d92ab495235de65abcd4e465e4cda385150cf098028cbc47cdf3511ba69544b9cfa7659a0bb1b81410680a9b6adb52e74386f06edbd558ece9ba189f46fd682c4b90e289135b68ce12ba2bc63d834e0ae802e353a5f4d23059f2897a097278205cdad84b2cd28a85a857ab220da116661d8d8b180365cbfec368b55d6cfc0b380e7c712d6d5f2e4b97b7504adc819bee34e0eff7cf7cbdb990bcf864eb825233be8ce98bf10a1a0dd6e7775f6192f4292d744423df690e785d60fdfb0b369ddf6959a2604b422c9268a0a3ff771308152ab24a69682daed70ce136dbde929bed90adf39144b561ad443c2785d03452f64a827383d56487b95f15bbae53dcd12a0e8e51413ca1de4986d78985ba9dd3cf89972a337869e55024aeb0e9a8574da93ad762a54194f690db4dbeea64d89d6d55a1475c90f4c0f71ab7de1bcd705392f52867a1afadc1166739d17dca486d382dbf88f4d9155e3f7a826cfefd04207438816e0ce69c47bc93e525b22d899390da9a67a6240ccf5dd72238f2e045842a2396be792fb89ef863c78886d744872b0cc95b9cb4e46c9d258e685d425311220b774095204e0e4adad876a11b6563618a2b99b9831857a5e81cfd2e26c2e29812e0dd9b790a38f447f6aba33a2d7ca83b4f07816e88a28cfbe61050eac4dace4fda9fcd0bb2ebb6c16aaf04c56d270d4c0f8781015c8a951a96a9c2195b4b9b0442a5e242ed7e0af17d3916129a6b5661fc0a38d5c967153651d263d8b6da024254dfa25b4b266131e8e8ff69402825563b84f449e76963e654c5527874f780fd180a6c536bfaa357ac06cdabaf19796ffbfa2e4ca443984332ded023088abd484e54abb576602581da22fe26bab8682b90cc7e42493a20a1e18dc75bd97f04055f637a2ac1e1508e3f437d2bcc810dba0d569676df5a4bd90841dfe35c6e86ba9419aea9f628ed45bc57a9d9ab005ab7cfede138fcf7e5c3ece329cd301cf92ecca4ff9e896663f6d6570aa090f72040772166a4ac3f6b1f2858c62aebfe3442aedae77f8ff0514a8160c7344fdd66586c6a6d1bb5ac7504c0d0179979ada351322adk,=	@=	>	?0Lyp'Tr_?RKiGV({MG%{ٴzoX‚gm'5?RKiGV(q%7 ؎1(JԺY՞iHd55c30fea69d341e25077c0f644af42e5c35a114\=	/usr\< with incomplete initializers (PR c/29091)
- fix ICE with multiple exit loop and -ftree-loop-linear
  (#208935, PR tree-optimization/29290)- fix i386/x86_64 legitimize_pic_address with TLS symbols (PR target/29198)
- fix gimplification of post-increment with side-effects on the inner
  expression (PR c/29154)- update from gcc-4_1-branch (-r117225:117266)
  - PR target/29230
- restrict single entry mem{{,p}cpy,move,set} optimization to vars
  and components thereof (PR middle-end/29272)
- fix java.util.Locale (Tom Tromey, #201712)- update from gcc-4_1-branch (-r117162:117225)
  - PRs classpath/28661, libgcj/29178, libstdc++/29179, libstdc++/29224
  - fix unwind info generation, broken in gcc-4.1.1-21
    (Roger Sayle, PR debug/29132)- update from gcc-4_1-branch (-r117069:117162)
  - PRs c++/28996, c++/29087, middle-end/26983
- fix -fprofile-use with anonymous namespaces (Jan Hubicka, PRs profile/20815,
  profile/26399)
- fix #pragma omp parallel and #pragma omp section that call nested
  functions (PRs middle-end/25261, middle-end/28790)- update from gcc-4_1-branch (-r117000:117069)
  - PRs fortran/21918, fortran/28526, fortran/28817, fortran/29060,
	fortran/29101, java/28754, java/28892, java/29013,
	middle-end/27226, middle-end/4520, tree-optimization/28900
- fix java.utils.logging.Logger (Mark Wielaard, #207111)
- fix gnu.javax.net.ssl.provider.SSLSocket (Tom Tromey, #206904)
- add support for Fortran OpenMP conditional inclusion (PR fortran/29097)
- add some -D_FORTIFY_SOURCE compile time strncat buffer overflow checks- update from gcc-4_1-branch (-r116958:117000)
  - PRs fortran/29051, target/28946
- fix single entry mem{{,p}cpy,move,set} optimization (Andrew Pinski,
  PR tree-opt/29059)- update from gcc-4_1-branch (-r116778:116958)
  - PRs ada/21952, ada/29025, c++/26957, fortran/28890, fortran/28923,
	fortran/28959, libfortran/28890, libfortran/28923, libfortran/28947,
	middle-end/28493, other/23541, other/26507, rtl-optimization/28243,
	rtl-optimization/28634, rtl-optimization/28636, rtl-optimization/28726,
	target/13685, target/26504, target/27537, target/27681, target/28621,
	target/29006, testsuite/28950, testsuite/29007
- fix #pragma omp atomic (PR middle-end/28046)
- speed up dominance frontiers calculation (Jan Hubicka)
- add README.libgcjwebplugin.so to libgcj %doc (Tom Fitzsimmons)
- fix gcc-gfortran %doc (#206333)
- fix gcc-debuginfo (#205500)- update from gcc-4_1-branch (-r116498:116778)
  - PRs c++/19809, c++/26102, c++/26195, c++/26571, c++/26670, c++/26671,
	c++/26696, c++/26917, c++/28860, c++/28878, c++/28886, fortran/20067,
	fortran/24866, fortran/25077, fortran/25102, fortran/28005,
	fortran/28873, fortran/28885, fortran/28908, libfortran/28005,
	middle-end/27724, middle-end/28814, other/22313,
	rtl-optimization/27616, rtl-optimization/28386, target/24367
- add primitive class object symbols to libgcj_bc.so (Tom Tromey,
  PR libgcj/28698)
- optimize single entry memcpy/mempcpy/memmove/memset already at the tree
  level (PR middle-end/27567)
- add dependencies to *-devel subpackages, so that e.g. ppc64
  libstdc++-devel requires 64-bit libstdc++, similarly for libgcj-devel
  and libgcj/zlib-devel- update from gcc-4_1-branch (-r116389:116498)
  - PRs c++/28056, c++/28058, c++/28595, c++/28853, c/27558,
	c/27893, c/28299, c/28418, driver/27622, libfortran/28452,
	libfortran/28542, target/27075
- optimize A / (B << N) where A and B is positive and B is a power of two
  (Alan Modra, #195924, PR rtl-optimization/26026)
- fix attribute handling in C++ (Jason Merrill, #204277, #204035,
  PRs c++/28659, c++/28863)- update from gcc-4_1-branch (-r116223:116389)
  - PRs c++/23372, c++/27714, c++/28346, c++/28385, fortran/18111,
	fortran/20886, fortran/25217, fortran/25828, fortran/28425,
	fortran/28496, fortran/28601, jp@properly.
- kabitool not being picked up (weird).- 2.6.18rc3- lockdep fix: ipv6
- 2.6.18rc2-git7- Refreshed NFS caching patches
- tweaked some ppc64 kdump config options- Remove make-symsets and built-in-where as now handled by kabitool- Update futex-death patch.- s390 utrace fix- Enable kdump on ppc64iseries.  yeah more rpms..- Add missing export for ia64 (#200396)- review all xen related patches.
- x86_64 dom0, x86_64 domU and i386 domU should work.
- fix xen i386 dom0 boot (#200382).- reduce hypervisor stack use with -O2, this really fixes bug (#198932)- 2.6.18rc2-git6- New utrace patch: unsafe_exec fix; s390 build enabled (but non-working).- new xen patch based on linux-2.6-xen cset 22749.
  and linux-2.6 cset 33089.- Enable sparsemem on ia64. (#108848)- update xen-hv to 10730 cset, should really fix huge timeout problems.- Workaround the huge timeouts problems on xen HV x86.
- xen update and cleanup/reorgatization of xen patches.- disable debug=y hypervisor build option because of stack overflow (#198932)- 2.6.18rc2-git4 & git5- Fix kabitool provided find-provides once again.- Use cset number instead of date for xen hypervisor.
- Update xen hypervisor to cset 10712.- 2.6.18rc2-git2 & git3
- Fix PI Futex exit crash.
- Fix an inotify locking bug.
- Add device mapper mirroring patches.- Change kabideps location.- New xen patch, fixes gso, xenoprof, vDSO.- Enable connector proc events.
- Enable PPC64 memory hotplug.
- 2.6.18rc2-git1- addia64-xen support, not enabled by default.
- add ia64-xen config- Patch from jakub to use sysv style hash for VDSO to fix booting
  on ia64 (#199634, #199595)
- Fix e1000 crc calculation for things to work with xen
- Update gfs2 patchset- Clean up spec changes for debuginfo generation to cover Xen case.
- New version of utrace patch, fixes /proc permissions. (#199014)- remove xenPAE option, as now the i686 xen kernel is PAE.- Fix to get xen debug info files in the right position.- apparently I was wrong and was fixed already- fixed build_debuginfo to not collect a stripped kernel- Add in support for nfs superblock sharing and cachefs
  patches from David Howells
- Disable 'make prepare' hack as it is breaking ppc symlinks
- Added tracking dirty pages patch from Peter Zijlstra
- Fix for Opteron timer scaling
- Fix for Calgary pci hang- big xen patch.
- enable xen again.
- redo xen config.
- i686 kernel for xen uses PAE now.
- new xen Hypervisor cset 10711.- New version of utrace patch, might fix #198780.- Workaround upstream "make prepare" bug by adding an additional prepare stage.
- Fix kabideps- Check in new version of kabitool for kernel deps.
- Fix kabitool for correct location of symvers.
- Various other fixes when things broke.- Support up to 4GB in the 586 kernel again.
- Drop the FPU optimisation, it may be the reason for
  strange SIGFPE warnings various apps have been getting.- Cleaned up a bunch of bogons in the config files.
- 2.6.18-rc1-git9,git10 & 2.6.18-rc2
- improvements to linked list debugging.- remove the ppc kdump patches- 2.6.18-rc1-git8- 2.6.18-rc1-git7
- More lockdep fixes.
- Fix slab corruption issue.- Add iscsi update being sent upstream for 2.6.18-rc2- Fix spec typo that swallowed kdump subpackage.- 2.6.18-rc1-git6- Build separate debuginfo subpackages instead of a single one.- 2.6.18-rc1-git5
- Make serial console installs on ia64 work again.
- Shrink struct inode.- Temporarily disable -headers subpackage until the problems which
  arise from brew not using older package are dealt with.- No headers subpackage for noarch build
- Fix PI-futexes to be properly unlocked on unexpected exit- Add sleazy fpu optimisation.   Apps that heavily
  use floating point in theory should get faster.- Add utrace. (ptrace replacement).- Build iSeries again
- Minor GFS2 update
- Enable kernel-headers subpackage- 2.6.18-rc1-git4- 2.6.18-rc1-git3
- Big bunch o' lockdep patches from Arjan.- 2.6.18-rc1-git2- Unified rhel and fedora srpm- Add lockdep annotate for bdev warning.
- Enable autofs4 to return fak@-,@,,,rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrpm-4.4.2.3-36.el5_11.src.rpmrpm-devel@@@@@@@@@@@@@@@@@@@@@@@JJ@elfutils-libelf-devellibbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdl.so.2()(64bit)libelf.so.1()(64bit)libm.so.6()(64bit)libnspr4.so()(64bit)libnss3.so()(64bit)libnssutil3.so()(64bit)libplc4.so()(64bit)libplds4.so()(64bit)libpopt.so.0()(64bit)libpthread.so.0()(64bit)librpm-4.4.so()(64bit)librpmbuild-4.4.so()(64bit)librpmdb-4.4.so()(64bit)librpmio-4.4.so()(64bit)librt.so.1()(64bit)libselinux-devellibselinux.so.1()(64bit)libsqlite3.so.0()(64bit)libz.so.1()(64bit)nss-develpoptrpmrpm-libsrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)sqlite-devel1.10.2.3-36.el5_114.4.2.3-36.el5_114.4.2.3-36.el5_113.0.4-14.0-14.4.2.3Tk`Te)QxUQg2`Q	POO`OKNN`N`N;N`LLL|)LvJj.Jf:`JK`J9g`JYJ`IAInIlI5I$`HgHH H`H6HHF`FTFFFFF`F`FzFw`Fd`ExEb%`EG`EG`E?`E`DN`D`DD`D6`DDDZy`DZy`DY'DR`DQ>DND=x`D<&D-`CC`Cތ`Cκ`CCCr`C`C`C}CqCIC3)`CBB`BBB`Bi`ByEByEBw`Bw`Bw`BvBvBsBp`Bp`BLrB?CB/qB,B,B$B#`BB|`B
*B`BM`A`AA`A5`A`AAnA'A`AFlorian Festi <ffesti@redhat.com> - 4.8.0-36Florian Festi <ffesti@redhat.com> - 4.8.0-35Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-34Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-33Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-32Florian Festi <ffesti@redhat.com> - 4.4.2.3-31Florian Festi <ffesti@redhat.com> - 4.4.2.3-30Florian Festi <ffesti@redhat.com> - 4.4.2.3-29Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-28Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-27Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-26Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-25Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-24Jindrich Novy <jnovy@redhat.com> - 4.4.2.3-23Jindrich Novy <jnovy@redhat.com> - 4.4.2.3-22Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-21Jindrich Novy <jnovy@redhat.com> - 4.4.2.3-20Jindrich Novy <jnovy@redhat.com> - 4.4.2.3-19Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-18Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-17Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-16Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-15Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-14Jindrich Novy <jnovy@redhat.com> - 4.4.2.3-13Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-12Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-11Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-10Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-9Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-8Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-7Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-6Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-5Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-4Jindrich Novy <jnovy@redhat.com> - 4.4.2.3-3Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-2Panu Matilainen <pmatilai@redhat.com> - 4.4.2.3-1Panu Matilainen <pmatilai@redhat.com> -  4.4.2-48Panu Matilainen <pmatilai@redhat.com> -  4.4.2-47Panu Matilainen <pmatilai@redhat.com> -  4.4.2-46Paul NasrjP@rf regression (Jeff Moyer) [571818]- [fs] gfs2: locking fix for potential dos (Steven Whitehouse) [572390] {CVE-2010-0727}
- [acpi] power_meter: avoid oops on driver load (Matthew Garrett) [566575]
- [net] r8169: fix assignments in backported net_device_ops (Ivan Vecera) [568040]
- [net] virtio_net: refill rx buffer on out-of-memory (Herbert Xu) [554078]- [cpu] fix amd l3 cache disable functionality (Jarod Wilson) [517586]
- [misc] backport upstream strict_strto* functions (Jarod Wilson) [517586]
- [wireless] rt2x00: fix work cancel race conditions (Stanislaw Gruszka) [562972]
- [net] igb: fix DCA support for 82580 NICs (Stefan Assmann) [513712]
- Revert: [ia64] kdump: fix a deadlock while redezvousing (Neil Horman) [506694]
- [block] cfq: kick busy queues w/o waiting for merged req (Jeff Moyer) [570814]
- [fs] cifs: max username len check in setup does not match (Jeff Layton) [562947]
- [fs] cifs: CIFS shouldn't make mountpoints shrinkable (Jeff Layton) [562947]
- [fs] cifs: fix dentry hash for case-insensitive mounts (Jeff Layton) [562947]
- [fs] cifs: fix len for converted unicode readdir names (Jeff Layton) [562947]
- [x86_64] xen: fix missing 32-bit syscalls on 64-bit Xen (Christopher Lalancette) [559410]
- [fs] gfs2: fix kernel BUG when using fiemap (Abhijith Das) [569610]
- [net] sctp: backport cleanups for ootb handling (Neil Horman) [555667] {CVE-2010-0008}
- [xen] vtd: ignore unknown DMAR entries (Don Dugger) [563900]- [wireless] iwlwifi: fix dual band N-only use on 5x00 (Stanislaw Gruszka) [566696]
- [net] be2net: critical bugfix from upstream (Ivan Vecera) [567718]
- [net] tg3: fix 5717 and 57765 asic revs panic under load (John Feeney) [565964]
- [net] bnx2x: use single tx queue (Stanislaw Gruszka) [567979]
- [net] igb: fix WoL initialization when disabled in eeprom (Stefan Assmann) [564102]
- [net] igb: fix warning in igb_ethtool.c (Stefan Assmann) [561076]
- [net] s2io: restore ability to tx/rx vlan traffic (Neil Horman) [562732]
- [net] ixgbe: stop unmapping DMA buffers too early (Andy Gospodarek) [568153]
- [net] e1000e: disable NFS filtering capabilites in ICH hw (Andy Gospodarek) [558809]
- [net] bnx2: update firmware and version to 2.0.8 (Andy Gospodarek) [561578]
- [net] mlx4: fix broken SRIOV code (Doug Ledford) [567730]
- [net] mlx4: pass eth attributes down to vlan interfaces (Doug Ledford) [557109]
- [x86_64] fix missing 32 bit syscalls on 64 bit (Wade Mealing) [559410]
- [s390] zcrypt: Do not remove coprocessor on error 8/72 (Hendrik Brueckner) [561067]
- [misc] usb-serial: add support for Qualcomm modems (Pete Zaitcev) [523888]
- [scsi] mpt2sas: fix missing initialization (Tomas Henzl) [565637]
- [i386] mce: avoid deadlocks during MCE broadcasts (Prarit Bhargava) [562862]
- [x86_64] k8: do not mark early_is_k8_nb as __init (Paolo Bonzini) [567275]
- [ia64] kdump: fix a deadlock while redezvousing (Neil Horman) [506694]
- [dm] raid45: constructor error path oops fix (Heinz Mauelshagen) [565494]
- [mm] prevent severe performance degradation hang fix (Dave Anderson) [544448]
- [net] cxgb3: memory barrier addition fixup (Steve Best) [561957]- [x86_64] mce: avoid deadlocks during MCE broadcasts (Prarit Bhargava) [562866]
- [scsi] device_handler: add netapp to alua dev list (Mike Christie) [562080]
- [misc] wacom: add Intuos4 support (Don Zickus) [502708]
- [scsi] be2iscsi: fix eh bugs and enable new hw support (Mike Christie) [564145]
- [net] ixgbe: initial support of ixgbe PF and VF drivers (Andy Gospodarek) [525577]
- [fs] ext4: avoid divide by 0 when mounting corrupted fs (Eric Sandeen) [547253]
- [net] bnx2x: update to 1.52.1-6 firmware (Stanislaw Gruszka) [560556]
- [net] bnx2x: update to 1.52.1-6 (Stanislaw Gruszka) [560556]
- [misc] hvc_iucv: alloc send/receive buffers in DMA zone (Hendrik Brueckner) [566202]
- [net] ixgbe: prevent speculatively processing descriptors (Steve Best) [566309]
- [fs] fix randasys crashes x86_64 systems regression (Peter Bogdanovic) [562857]
- [scsi] fix bugs in fnic and libfc (Mike Christie) [565594]
- [net] tg3: fix 57765 LED (John k@own@redhat.com>Preston Brown <pbrown@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>- Fix CVE-2012-5669
    (Use correct array size for checking `glyph_enc')
- Resolves: #903539- Fix CVE-2012-{1126, 1127, 1130, 1131, 1132, 1134, 1136,
  1137, 1139, 1140, 1141, 1142, 1143, 1144}
- Protect against invalid string offsets in pcf_get_properties()
- Check bytes per row for overflow in _bdf_parse_glyphs()
- Resolves: #806267- Add freetype-2.2.1-CVE-2011-3439.patch
    (Various loading fixes.)
- Resolves: #754010- Add freetype-2.2.1-CVE-2011-3256.patch
    (Handle some border cases.)
- Resolves: #747082- Add freetype-2.2.1-CVE-2010-3855.patch
    (Protect against invalid `runcnt' values.)
- Resolves: #651760- Modify freetype-2.2.1-CVE-2010-3054.patch
- Resolves: #638143- Add freetype-2.2.1-CVE-2010-2806.patch
    (Protect against negative string_size. Fix comparison.)
- Add freetype-2.2.1-CVE-2010-3311.patch
    (Don't seek behind end of stream.)
- Add freetype-2.2.1-CVE-2010-3054.patch
    (Protect against nested `seac' calls.)
- Add freetype-2.2.1-CVE-2010-2808.patch
    (Check the total length of collected POST segments.)
- Resolves: #638143- Add freetype-2.2.1-CVE-2010-1797.patch
- Resolvs: #CVE-2010-1797- Add freetype-2.2.1-axis-name-overflow.patch
    (Avoid overflow when dealing with names of axes)
- Resolves: #614013- Modify freetype-2.2.1-CVE-2010-2519.patch (additional fix)
    (If the type of the POST fragment is 0, the segment is completely ignored)
- Resolves: #614013- Add freetype-2.2.1-CVE-2010-2527.patch
    (Use precision for `%s' where appropriate to avoid buffer overflows)
- Resolves: #614013- Add freetype-2.2.1-CVE-2010-2498.patch
    (Assure that `end_point' is not larger than `glyph->num_points')
- Add freetype-2.2.1-CVE-2010-2499.patch
    (Check the buffer size during gathering PFB fragments)
- Add freetype-2.2.1-CVE-2010-2500.patch
    (Use smaller threshold values for `width' and `height')
- Add freetype-2.2.1-CVE-2010-2519.patch
    (Check `rlen' the length of fragment declared in the POST fragment header)
- Resolves: #614013- Add freetype-2009-CVEs.patch
- Resolves: #496112- Add freetype-2.3.5-CVEs.patch
- Resolves: #450911- Add freetype-2.3.4-ttf-overflow.patch
- Resolves: #240575- Add freetype-2.2.1-bdf-overflow.patch
- Resolves: #234228- Backport binary-search fixes from HEAD
- Add freetype-2.2.1-ttcmap.patch
- Resolves: #208734, #218326- Fix rendering issue with some Asian fonts.
- Add freetype-2.2.1-fix-get-orientation.patch
- Resolves: #207261- Copy non-X demos even if not compiling with_xfree86.- Step up to retag.  Forgot to add patch to CVS first time :(.- Add freetype-2.2.1-zero-item-size.patch, to fix crasher.
- Resolves #214048- Add X11_PATH=/usr to "make"s, to find modern X.
- Resolves #212199- Fix crasher https://bugs.freedesktop.org/show_bug.cgi?id=6841
- Add freetype-2.2.1-memcpy-fix.patch- Add BuildRequires: libX11-devel (#205355)- Add freetype-composite.patch and freetype-more-composite.patch
  from upstream. (#131851)- Require pkgconfig in the -devel package- pass --disable-static to %configure. (#172628)- don't package static libs- fix a problem with the multilib patch (#202366)- fix multilib issues- rebuild- Remove unused BuildRequires- Update to 2.2.1
- Remove FreeType 1, to move to extras
- Install new demos ftbench, ftchkwd, ftgamma, and ftvalid
- Enable modules gxvalid and otvalid- add buildrequires libICE-devel, libSM-devel- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Remove references to obsolete /usr/X11R6 paths- Switch requires to modular X- BuildRequire gettext- fix 'without_bytecode_interpreter 0' build: freetype-2.1.10-enable-ft2-bci.patch- Update to 2.1.10
- Add necessary fixes- Fix freetype-config on 64 j"02@231 SR-IOV device (ddugger@redhat.com ) [493152]
- [pci] restore saved SR-IOV state (ddugger@redhat.com ) [493152]
- [pci] initialize and release SR-IOV capability (ddugger@redhat.com ) [493152]
- [pci] add a new function to map BAR offsets (ddugger@redhat.com ) [493152]
- [pci] allow pci_alloc_child_bus to handle a NULL bridge (ddugger@redhat.com ) [493152]
- [pci] enhance pci_ari_enabled (ddugger@redhat.com ) [493152]
- [pci] fix ARI code to be compatible with mixed systems (ddugger@redhat.com ) [493152]
- [pci] support PCIe ARI capability (ddugger@redhat.com ) [493152]
- [pci] export __pci_read_base (ddugger@redhat.com ) [493152]
- [pci] fix 64-vbit prefetchable memory resource BARs (ddugger@redhat.com ) [493152]
- [pci] handle 64-bit resources better on 32-bit machines (ddugger@redhat.com ) [493152]
- [pci] rewrite PCI BAR reading code (ddugger@redhat.com ) [493152]
- [xen] add Credit Scheduler Fairness and hard virt (Justin M. Forbes ) [432700]
- [xen] x86_64: add 1GB page table support (Bhavna Sarathy ) [251982]- [fs] vfs freeze: use vma->v_file to get to superblock (Eric Sandeen ) [476148]
- [net] tg3: allow 5785 to work when running at 10Mbps (Andy Gospodarek ) [469772]
- [net] af_iucv: race when queuing incoming iucv messages (Hans-Joachim Picht ) [499626]
- [trace] sunrpc: adding trace points to status routines (Steve Dickson ) [499008]
- [gfs2] fix glock ref count issue (Steven Whitehouse ) [485098]
- [kabi] add acpi_bus_register_driver (Jon Masters ) [462911]
- [kabi] add nobh_truncate_page and kernel_read (Jon Masters ) [497276]
- [usb] support Huawei's mode switch in kernel (Pete Zaitcev ) [485182]
- [scsi] ibmvscsi: LPAR hang on a multipath device (AMEET M. PARANJAPE ) [498927]
- [wireless] mac80211: scanning related fixes (John W. Linville ) [498719]
- [fs] ecryptfs: remove ecryptfs_unlink_sigs warnings (Eric Sandeen ) [499171]
- [fs] ext4: re-fix warning on x86 build (Eric Sandeen ) [499202]
- [ppc64] adjust oprofile_cpu_type detail (AMEET M. PARANJAPE ) [496709]
- [nfs] SELinux can copy off the top of the stack (Eric Paris ) [493144]
- [xen] x86: explicitly zero CR[1] in getvcpucontext (Miroslav Rezanina ) [494876]
- [xen] x86: fix overflow in the hpet code (Rik van Riel ) [449346]
- [xen] x86: fixes to the 'no missed-tick accounting' code (Rik van Riel ) [449346]
- [xen] introduce 'no missed-tick accounting' (Rik van Riel ) [449346]
- [xen] x86: misc fixes to the timer code (Rik van Riel ) [449346]
- [xen] x86: initialize vlapic->timer_last_update (Rik van Riel ) [449346]- [ia64] xen: switch from flipping to copying interface (Chris Lalancette ) [479754]
- [scsi] fnic: init retry counter (Mike Christie ) [484438]
- [misc] add some long-missing capabilities to CAP_FS_MASK (Eric Paris ) [499076 497272] {CVE-2009-1072}
- [crypto] add ansi_cprng test vectors (Jarod Wilson ) [497891]
- [crypto] add rng self-test infra (Jarod Wilson ) [497891]
- [md] bitmap merge feature (Doug Ledford ) [481226]
- [md] fix lockup on read error (Doug Ledford ) [465781]
- [md] dm-raid45: corrupt data and premature end of synch (Heinz Mauelshagen ) [480733 479383]
- [fs] generic freeze ioctl interface (Eric Sandeen ) [476148]
- [scsi] add mpt2sas driver (Tomas Henzl ) [475665]
- [misc] kprobes: fix deadlock issue (John Villalovos ) [210555]
- [block] disable iostat collection in gendisk (Jerome Marchand ) [484158]
- [block] fix request flags (Jerome Marchand ) [484158]
- [misc] fix blktrace api breakage (Hans-Joachim Picht ) [475334]
- [fs] fuse: update for RHEL-5.4 (Josef Bacik ) [457975]- Revert: [scsi] MPT Fusion: update to version 3.04.07rh (Tomas Henzl ) [475455]
- Revert: [scsi] make fusion MPT driver legacy I/O port free (Tomas Henzl ) [475451]
- Revert: [scsi] MPT fusion: remove annoying debug message (Tomas Henzl ) [475455]
- [openib] ehca: fix performance during creation of QPs (AMEET M. PARANJAPE ) [498527]
- [scsi] qla4xxx: fix driver fault recovery (Marcus Barrow ) [497478]
- [misc] make bus_find_device more robust, match upstream (Don Dutile ) [492488]
- [md] dm snapshot: refactor __find_0kpSL@RRRRRR
RRRRR?f—rb8]97n?PGV(\6Jih߰c6Y}ThޑJ[s=94҈?PGV(,AWbx쀝7"a`k|[t,ade05aa710949985bc9a5d5b7138980339eba85ba\<j0IP,@Feeney) [566016]
- [net] tg3: fix race condition with 57765 devices (John Feeney) [565965]
- [fs] gfs2: use correct GFP for alloc page on write (Steven Whitehouse) [566221]
- [scsi] lpfc: update version for 8.2.0.63.3p release (Rob Evers) [564506]
- [scsi] lpfc: fix driver build issues in rhel5.5 (Rob Evers) [564506]
- [scsi] lpfc: relax event queue field checking (Rob Evers) [564506]
- [scsi] lpfc: implement the PORT_CAPABITIES mailbox cmd (Rob Evers) [564506]
- [scsi] lpfc: fix a merge issue (Rob Evers) [564506]
- [scsi] lpfc: Add support for new SLI features (Rob Evers) [564506]
- [scsi] lpfc: Add support for 64-bit PCI BAR region 0 (Rob Evers) [564506]
- [nfs] fix a deadlock in the sunrpc code (Steve Dickson) [548846]
- [fs] ecryptfs: fix metadata in xattr feature regression (Eric Sandeen) [553670]
- [scsi] qla2xxx: return FAILED if abort command fails (Rob Evers) [559972]
- [virtio] fix module loading for virtio-balloon module (Anthony Liguori) [564361]
- [mm] xen: make mmap() with PROT_WRITE (Andrew Jones) [562761]
- [hwmon] w83627hf: fix data to platform_device_add_data (Dean Nelson) [557172]
- [hwmon] smsc47m1: fix data to platform_device_add_data (Dean Nelson) [560944]
- [hwmon] it87: fix sio_data to platform_device_add_data (Dean Nelson) [559950]
- [hwmon] f71805f: fix sio_data to platform_device_add_data (Dean Nelson) [564399]
- [base] make platform_device_add_data accept const pointer (Dean Nelson) [557172 559950 560944 564399]
- [net] forcedeth: fix putting system into S4 (Matthew Garrett) [513203]
- [net] netfilter: allow changing queue length via netlink (Steve Best) [562945]
- [mm] i386: fix iounmap's use of vm_struct's size field (Danny Feng) [549465]
- [ppc] fix sched while atomic error in alignment handler (Steve Best) [543637]
- [pci] aer: disable advanced error reporting by default (Prarit Bhargava) [559978]
- [s390] qeth: set default BLKT settings by OSA hw level (Hendrik Brueckner) [559621]
- [net] e1000e: fix deadlock unloading module on some ICH8 (Andy Gospodarek) [555818]
- [misc] rwsem: fix a bug in rwsem_is_locked() (Amerigo Wang) [526092]
- [s390] clear high-order bits after switch to 64-bit mode (Hendrik Brueckner) [546302]- [net] wireless fixes from 2.6.32.7 (John Linville) [559711]
- [net] wireless fixes from 2.6.32.4 (John Linville) [559711]
- [net] wireless fixes through 2.6.32.3 (John Linville) [559711]
- [net] wireless fixes from 2.6.32.2 (John Linville) [559711]- [net] be2net: latest bugfixes from upstream for rhel5.5 (Ivan Vecera) [561322]
- [infiniband] fix bitmask handling from QP control block (Steve Best) [561953]
- [infiniband] fix issue w/sleep in interrupt ehca handler (Steve Best) [561952]
- [char] ipmi: fix ipmi_watchdog deadlock (Tony Camuso) [552675]
- [net] cnic: additional fixes for rhel5.5 update (Mike Christie) [517378]
- [net] cxgb3: add memory barriers (Steve Best) [561957]
- [fs] nfsv4: distinguish expired from stale stateid (Wade Mealing) [514654]
- [net] igb: fix msix_other interrupt masking (Stefan Assmann) [552348]
- [net] niu: fix deadlock when using bonding (Andy Gospodarek) [547943]
- [x86] xen: invalidate dom0 pages before starting guest (Christopher Lalancette) [466681]
- [cpufreq] powernow-k8: fix crash on AMD family 0x11 procs (Bhavna Sarathy) [555180]
- [misc] ptrace: PTRACE_KILL hangs in 100% cpu loop (Vitaly Mayatskikh) [544138]
- [scsi] megaraid: fix 32-bit apps on 64-bit kernel (Tomas Henzl) [518243]
- [misc] fix APIC and TSC reads for guests (Prarit Bhargava) [562006]
- [mm] fix sys_move_pages infoleak (Eugene Teo) [562590] {CVE-2010-0415}
- [fs] aio: fix .5% OLTP perf regression from eventfd (Jeff Moyer) [548565]
- [net] sky2: fix initial link state errors (Andy Gospodarek) [559329]
- [x86_64] wire up compat sched_rr_get_interval (Danny Feng) [557092]
- [net] netfilter: enforce CAP_NET_ADMIN in ebtables (Danny Feng) [555243] {CVE-2010-0007}
- [misc] fix kernel info leak with print-fatal-signals=1 (Danny Feng) [554584] {CVE-2010-0003}
- [fs] gfs2: don't withdraw on partial rindex entries (Benjamin Marzinski) [553447]
- [nkp)-@--Q`?|d
	 	6	\l	t
|
$8Lp()*G+T,X-\8`#9#:
"#>?BDFG$H4IDXHYLZ`[d\h]x^bdcehfmkolvtuvw8xHyX{xAA
"LPTgXh\Cirqbalance0.5516.el5_11IRQ balancing daemon.irqbalance is a daemon that evenly distributes IRQ load across
multiple CPUs for enhanced performance.U]builder17.centos.orgzCentOS-5CentOSGPL/OSLSystem Environment/Baselinuxx86_64/sbin/chkconfig --add irqbalanceif [ "$1" = "0" ] ; then
 /sbin/chkconfig --del irqbalance
fi^h8큤큤U]U]U]U]d54f902ad6c68918dbaa8fbdfa4069cc24e010dddb946b58f1efc35fed5f2746bcf38727316dea2f513a4335a792131baf43eae745080623ac4485fafd113d88rootrootrootrootrootrootrootrootirqbalance-0.55-16.el5_11.src.rpmirqbalance@	@@@@@@@@@@JJ@/bin/sh/bin/sh/bin/sh/bin/sh/sbin/chkconfig/sbin/serviceglib2libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libglib-2.0.so.0()(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.4-14.0-14.4.2.3/sbin/chkconfig --add irqbalance
exit 0kernel-utilsURwI`I`IvI`IvI`HG`G<`GGT|`G`F:F%C`E&`E&`E}E[ERS`EJj`E5R`E`D8`DD`DD`D$CC`C8C`B$B	6`AL`AAĨ`Petr Holasek <pholasek@redhat.com> - 0.55-16Neil Horman <nhorman@redhat.com> - 0.55-15Neil Horman <nhorman@redhat.com> - 0.55-14Neil Horman <nhorman@redhat.com> - 0.55-13Neil Horman <nhorman@redhat.com> - 0.55-12Neil Horman <nhorman@redhat.com> - 0.55-11Neil Horman <nhorman@redhat.com> - 0.55.10Neil Horman <nhorman@redhat.com> - 0.55.9Neil Horman <nhorman@redhat.com> - 0.55-8Neil Horman <nhorman@redhat.com> - 0.55-7Neil Horman <nhorman@redhat.com> - 0.55-4Neil Horman <nhorman@redhat.com> - 0.55-3Neil Horman <nhorman@redhat.com> - 0.55-2Neil Horman <nhorman@redhat.com> - 0.55-1Neil Horman <nhorman@redhat.com> - 0.54-1Neil Horman <nhorman@redhat.com> - 1.13-8Neil Horman <nhorman@redhat.com> - 1.13-7Neil Horman <nhorman@redhat.com> - 1.13-6Neil Horman <nhorman@redhat.com> - 1.13-5Peter Jones <pjones@redhat.com> - 1.13-4Jesse Keating <jkeating@redhat.com> - 1.13-2Neil Horman <nhorman@redhat.com>Dave Jones <davej@redhat.com>Jesse Keating <jkeating@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Jesse Keating <jkeating@redhat.com>Jesse Keating <jkeating@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>- Fix bug in honoring of IRQBALANCE_BANNED_INTERRUPTS (bz 1212965)- Fix another stupid typo in the script (bz 471574)- Fix mistake in irqbalance init script (bz 471574)-k`,@,,,at <pnasrat@redhat.com> - 4.4.2-45Paul Nasrat <pnasrat@redhat.com> - 4.4.2-44Paul Nasrat <pnasrat@redhat.com> - 4.4.2-43Panu Matilainen <pmatilai@redhat.com> -  4.4.2-42Panu Matilainen <pmatilai@redhat.com> -  4.4.2-41Paul Nasrat <pnasrat@redhat.com> - 4.4.2-40Paul Nasrat <pnasrat@redhat.com> - 4.4.2-39Paul Nasrat <pnasrat@redhat.com> - 4.4.2-38Paul Nasrat <pnasrat@redhat.com> - 4.4.2-37Paul Nasrat <pnasrat@redhat.com> - 4.4.2-36Paul Nasrat <pnasrat@redhat.com> - 4.4.2-35Paul Nasrat <pnasrat@redhat.com> - 4.4.2-34Paul Nasrat <pnasrat@redhat.com> - 4.4.2-33Paul Nasrat <pnasrat@redhat.com> - 4.4.2-32Paul Nasrat <pnasrat@redhat.com> - 4.4.2-31Paul Nasrat <pnasrat@redhat.com> - 4.4.2-30David Cantrell <dcantrell@redhat.com> - 4.4.2-29Paul Nasrat <pnasrat@redhat.com> - 4.4.2-28Paul Nasrat <pnasrat@redhat.com> - 4.4.2-27Paul Nasrat <pnasrat@redhat.com> - 4.4.2-26Paul Nasrat <pnasrat@redhat.com> - 4.4.2-25Paul Nasrat <pnasrat@redhat.com> - 4.4.2-24Jeremy Katz <katzj@redhat.com> - 4.4.2-23Jeremy Katz <katzj@redhat.com> - 4.4.2-22Jeremy Katz <katzj@redhat.com> - 4.4.2-21Paul Nasrat <pnasrat@redhat.com> - 4.4.2-20Paul Nasrat <pnasrat@redhat.com> - 4.4.2-19Paul Nasrat <pnasrat@redhat.com> - 4.4.2-18Jeremy Katz <katzj@redhat.com> - 4.4.2-17Paul Nasrat <pnasrat@redhat.com> - 4.4.2-16Jesse Keating <jkeating@redhat.com> - 4.4.2-15.2Jesse Keating <jkeating@redhat.com> - 4.4.2-15.1Paul Nasrat <pnasrat@redhat.com> - 4.4.2-15Paul Nasrat <pnasrat@redhat.com> - 4.4.2-14Paul Nasrat <pnasrat@redhat.com> - 4.4.2-13Alexander Larsson <alexl@redhat.com> - 4.4.2-12Paul Nasrat <pnasrat@redhat.com> - 4.4.2-11Paul Nasrat <pnasrat@redhat.com> - 4.4.2-10Paul Nasrat <pnasrat@redhat.com> - 4.4.2-9Paul Nasrat <pnasrat@redhat.com> - 4.4.2-8Tomas Mraz <tmraz@redhat.com> - 4.4.2-7Florian La Roche <laroche@redhat.com>Paul Nasrat <pnasrat@redhat.com> - 4.4.2-5Paul Nasrat <pnasrat@redhat.com> - 4.4.2-4Paul Nasrat <pnasrat@redhat.com> - 4.4.2-3Paul Nasrat <pnasrat@redhat.com> - 4.4.2-2Paul Nasrat <pnasrat@redhat.com> - 4.4.2-1Paul Nasrat <pnasrat@redhat.com> - 4.4.1-21Paul Nasrat <pnasrat@redhat.com> - 4.4.1-20Paul Nasrat <pnasrat@redhat.com> - 4.4.1-19Paul Nasrat <pnasrat@redhat.com> - 4.4.1-18.1Paul Nasrat <pnasrat@redhat.com> - 4.4.1-18Paul Nasrat <pnasrat@redhat.com> - 4.4.1-17Paul Nasrat <pnasrat@redhat.com> - 4.4.1-16Paul Nasrat <pnasrat@redhat.com> - 4.4.1-15Paul Nasrat <pnasrat@redhat.com> - 4.4.1-14Paul Nasrat <pnasrat@redhat.com> - 4.4.1-13Miloslav Trmac <mitr@redhat.com> - 4.4.1-12Paul Nasrat <pnasrat@redhat.com> - 4.4.1-11Jeremy Katz <katzj@redhat.com> - 4.4.1-10Thomas Woerner <twoerner@redhat.com> 4.4.1-9Paul Nasrat <pnasrat@redhat.com> 4.4.1-8Jeff Johnson <jbj@jbj.org> 4.4.1-7Jeremy Katz <katzj@redhat.com> - 4.4.1-6Jeremy Katz <katzj@redhat.com> - 4.4.1-5Jeremy Katz <katzj@redhat.com> - 4.4.1-4Jeremy Katz <katzj@redhat.com> - 4.4.1-3Jeff Johnson <jbj@jbj.org> 4.4.1-1Jeff Johnson <jbj@jbj.org> 4.4.1-0.24Jeff Johnson <jbj@jbj.org> 4.4.1-0.22Jeff Johnson <jbj@jbj.org> 4.4.1-0.20Jeff Johnson <jbj@jbj.org> 4.4.1-0.16Jeff Johnson <jbj@jbj.org> 4.4.1-0.14Jeff Johnson <jbj@jbj.org> 4.4.1-0.12Jeff Johnson <jbj@jbj.org> 4.4.1-0.10Jeff Johnson <jbj@jbj.org> 4.4.1-0.8Jeff Johnson <jbj@jbj.org> 4.4.1-0.7Jeff Johnson <jbj@jbj.org> 4.4.1-0.6Jeff Johnson <jbj@jbj.org> 4.4.1-0.5Jeff Johnson <jbj@jbj.org> 4.4.1-0.3Jeff Johnson <jbj@jbj.org> 4.4.1-0.2Jeff Johnson <jbj@jbj.org> 4.4.1-0.1- Fix warning when applying the patch for #1163057- Fix race condidition where unchecked data is exposed in the file system
  (CVE-2013-6435)(#1163057)- Fix segfault on rpmdb addition when header unload fails (#706935)
- Fix segfault on invalid OpenPGP packet (#743203)- Account for excludes and hardlinks wrt payload max size (#716853)
- Fix payload size tag generation on big-endian systems (#648516)- Track all install failures within a transaction (#671194)- fix changelog (bug #707677 is actually #808547)- Document -D and -E options in man page (#814602)
- Require matching ar}kT@B;?:d

		G	==	f=
===
===Fh=\t(8H9H:JHF&G&=H'=I(=X)xY)\)=]*=^.'=b6>d6Be6Gf6Lk6Nl6Ut6p=u7d=v8Xw8p=x9d={:X=:::A:A
;>;h;l=;g;h;Cspecspo134.el5.centosPackage descriptions, summaries, and groups.The specspo package contains the portable object catalogues used to
internationalize packages.P)`builder10.centos.org8lCentOS-5CentOSGPLDocumentationlinuxnoarch#^E\r.*
1i3#<^-'
(:{k
Uq3Y=7V
3^V$v#A]D`kk
y^^v_Q^pڐP)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`P)`dfc6e39fca40643bb8592270156b04b2408fc94eadb3e745557025f31a338a14a9865ebbfe56e3b3492bf3911e820a191fa6d4a536a4f1900c02efbf34e4746a77f57fb91f4ed4756c48b303ea53752f8072c6e1fab01297e88fdd89ab2e58d4053bb6b6059b2c2f0338965270fd327c6a780e1f4fb658ba43aa18624e803ee5f9814d77f5dde39f3de174b025c27d8cf047b6b0d430d0306831e28d78918bd0c77c437739e49d2272999581391b89555d97293623ebf3a4191734a6c6a1d71512e47c96861f64b3f47ed372648da05c91503206931720ad3e1bf09a6757bbd81cef21084a6e5f517da47c6aa1c186935cb6498afeb8128506c41a3a081ba40ac7406c0e57388b3beacd823451364c3c8502e5797903795bcba3ebdff383773db7e36e06bb06c47f70a488786ed2bbaedb3dfc211743d8e0814262d2727606dde99e79912ab2482099b9961e944dc00964fb475a57b3bee7696258818ab71bad8a039b2bd41f616f44d31733734af941493aff8fadd6eaad728c64be48b6174f9339123589b9a802b9875b7e48fe0eb8f18f59469005e1aa91ae4c3396f37d9f3097465f04d1ed3fd06d4cb422c78c013acbbef45f4a8c0d29fdc1a7960a1a78bf295440ec2bb143dbce2e21ec7fcfd10f82b78e11250c8e8758297902acd6845f27eb6599f224692c78beeac967aab3fa14bac80743dbedf5181c85c5b382efeeeb81fc16ef81667d51ac2c9a3f73486bee9d901799a52754b0ddc4015122ff81267968e861aba81365d6675984810319f7b19677e49fa7cca1a1552a1ccc0bfad4dd7b22bc8b921aa8939222ab76d80ced52a0af3ec9698ea0e99a72c7908acf87cefc25653130fb2795cd97c082c37e1f8f8d883e35258e36897e58a76480c104c170d7d1aa144352ee41adde2e0fc0031b9927970956d15685755d250445c52a9d1641db8cf7faa2caa462097e6088ebc8e916a94e2c52680817d049d65d259c034cfd7ffdf6dbfc116ce089e2fb8287eb94cd53cf34a37acb4e8955c39624909a32e9f8ea311b310f628e96b4db44eb75e6340fd75cf79d568c31613e21e022e47e6e18ee5c5f2280ef57f9a9f3956907c431950adb780a43825e5b5eb05f27eb6599f224692c78beeac967aab3579da59c51f3b14065fa48eb446f8f96b742e8d8f5e0e27a1166adbe758bfbbdaf42093a9a8da517fdcd5d8dd2bb7ef99e208732dfa7a0536010a7c7899193c7d22d7ff463e8b638712e7ded796a2693b9aaf93eba79ae48b793489eef964e8c8527ed7dbbd5f0aedfc601a36d19b85b5f27eb6599f224692c78beeac967aab3fd0ddaf56918ced546c88cb3c4ad358643f5e7373cbcda495f61f7c231e6c86ak@hyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Matt Wilson <msw@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>- pam_rhosts_auth: fix the negative user match case- pam_rhosts_auth: switch the order of user and hostname matching- better keep also the regular environment variables for backwards
  compatibility with old pam_exec scripts- fix the user name matching in pam_cracklib old password handling too- optimize pam_listfile to use pam_modutil_user_in_group_nam_nam() (#551312)
- export environment variables in pam_exec (#554518)
- fix user name matching in pam_unix remember feature (#768087)
- added pam_cracklib options maxclassrepeat and gecos_check
- pam_pwhistory now always saves the old password even for root- distinguish groups and users with the () syntax in pam_access
  if nodefgroup option is specified
- do not truncate /var/log/faillog and /var/log/tallylog on upgrade
- remove superfluous plurals in .po files- fix insecure dropping of priviledges in pam_xauth
  and pam_mail - CVE-2010-3316 (#637898), CVE-2010-3435 (#641335)
- fix insecure executing of scripts with user supplied environment
  variables in pam_namespace - CVE-2010-3853 (#643043)- fix string matching in pam_time and pam_group (#509013)- add pam_pwhistory module (#451085)
- add group audio in post script (#244688)- add group audio to sound devices when no console user owns them (#244688)
- resolve pam access origin entry only when it makes sense (#459057)
- silence the strict-aliasing warnings (#462647)
- pam_keyinit: save old uid so we can revert to it (#466411)
- pam_filter: make it use pty subsystem (#473970)
- add pam_faildelay module to be able to set the failure delay (#476217)
- pam_tty_audit: fix double free when open_only option is used (#476833)
- allow root toDko0@ann@redhat.com> - 1.1.1-48.elSoren Sandmann <sandmann@redhat.com> - 1.1.1-47.fc6Soren Sandmann <sandmann@redhat.com> - 1.1.1-46.fc6Soren Sandmann <sandmann@redhat.com> - 1.1.1-45.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-44.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-43.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-42.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-41.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-40.fc6Kristian Høgsberg <krh@redhat.com> 1.1.1-39.fc6Adam Jackson <ajackson@redhat.coM> - 1.1.1-38.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-37.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-36.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-35.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-34.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-33.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-32.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-31.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-30.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-29.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-28.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-27.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-26.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-25.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-24.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-23.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-22.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-21.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-20.fc6Adam Jackson <ajackson@redhat.com> - 1.1.1-19.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-18.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-17.fc5.aiglxKristian Høgsberg <krh@redhat.com> - 1.1.1-17.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-16.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-15.fc6Kevin E Martin <kem@redhat.com> - 1.1.1-14.fc6Kristian Høgsberg <krh@redhat.com> - 1.1.1-13.fc5.aiglxAdam Jackson <ajackson@redhat.com> 1.1.1-13.fc6Mike A. Harris <mharris@redhat.com> 1.1.1-12.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-11.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-10.fc6Mike A. Harris <mharris@redhat.com> 1.1.1-8.fc6Mike A. Harris <mharris@redhat.com>Mike A. Harris <mharris@redhat.com> 1.1.1-7.fc6Jeremy Katz <katzj@redhat.com> 1.1.1-6.fc6Kristian Høgsberg <krh@redhat.com>  1.1.1-5.fc6Kristian Høgsberg <krh@redhat.com>  1.1.1-5.fc5.aiglxAdam Jackson <ajackson@redhat.com> 1.1.1-4.fc6Jesse Keating <jkeating@redhat.com> 1.1.1-3.1.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-3.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-2.fc6Adam Jackson <ajackson@redhat.com> 1.1.1-1.fc6Kristian Høgsberg <krh@redhat.com>  1.1.0-27.fc6Kristian Høgsberg <krh@redhat.com>  1.1.0-26Mike A. Harris <mharris@redhat.com> 1.1.0-25.fc6Mike A. Harris <mharris@redhat.com>Adam Jackson <ajackson@redhat.com> 1.1.0-24Adam Jackson <ajackson@redhat.com> 1.1.0-23Mike A. Harris <mharris@redhat.com> 1.1.0-22Kristian Høgsberg <krh@redhat.com> 1.1.0-21Mike A. Harris <mharris@redhat.com> 1.1.0-20Kristian Høgsberg <krh@redhat.com> 1.1.0-19Kristian Høgsberg <krh@redhat.com> 1.1.0-18Adam Jackson <ajackson@redhat.com> 1.1.0-17Mike A. Harris <mharris@redhat.com> 1.1.0-16Adam Jackson <ajackson@redhat.com> 1.1.0-15Kristian Høgsberg <krh@redhat.com> 1.1.0-14Jeremy Katz <katzj@redhat.com> 1.1.0-13Adam Jackson <ajackson@redhat.com> 1.1.0-12Kristian Høgsberg <krh@redhat.com> 1.1.0-11Adam Jackson <ajax@redhat.com> 1.1.0-10Adam Jackson <ajax@redhat.com> 1.1.0-9Kristian Høgsberg <krh@redhat.com> 1.1.0-8Mike A. Harris <mharris@redhat.com> 1.1.0-7Jeremy Katz <katzj@redhat.com> 1.1.0-6Jeremy Katz <katzj@redhat.com> 1.1.0-5Adam Jackson <ajackson@redhat.com> 1.1.0-4Adam Jackson <ajackson@redhat.com> 1.1.0-3Mike A. Harris <mharris@redhat.com> 1.1.0-2Adam Jackson <ajackson@redhat.com> 1.1.0-1Mike A. Harris <mharris@redhat.com> 1.0.99.903-2Adam Jackson <ajackson@redhat.com> 1.0.99.903-1Adam Jackson <ajackson@redhat.com> 1.0.99.902-1Adam Jackson <ajackson@redhat.com> 1.0.99.901-6Kristian Høgsberg <krh@redhat.com> 1.0.99.901-5Kristian Høgsberg <krh@redhat.com> 1.0.99.901-4Kristianl2.@2.1.	nmlRcbsqrkdgethf\au~|i{ywxfrpl1:3.13-8.el51:3.13-8.el5	










quotagrpadminsquotatabwarnquota.confquotacheckquotaoffquotaonquotarquota.hrquota.xconvertquotaedquotaquotastatsrepquotarpc.rquotadsetquotawarnquotaquota.moquota.moquota.1.gzquotactl.2.gzrquota.3.gzconvertquota.8.gzedquota.8.gzquotacheck.8.gzquotaoff.8.gzquotaon.8.gzquotastats.8.gzrepquota.8.gzrpc.rquotad.8.gzrquotad.8.gzsetquota.8.gzwarnquota.8.gz/etc//sbin//usr/bin//usr/include/rpcsvc//usr/sbin//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/man/man1//usr/share/man/man2//usr/share/man/man3//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII C program textASCII English textELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippeddirectorysymbolic link to `quotaon'symbolic link to `quotaon.8.gz'symbolic link to `rquotad.8.gz' %+28
RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
RRRRRRRRRRRRR	R
RRR? ftJ#9yn˲?P2GV(/qZFeR0ѽYm p(њn4pۈ?P2GV(i	1t4=oڑWZ\2#!(I!#pF@7b90ed82157bc369209c46d4fbd9d5815ee6d964\=-\<hXiE%%AD1&6\U|U}\|\}+x~C31AjM avDLkUx!>p	Yp	}	.֒,qs@b]/Y/3],A܁_tLKW
d"rWu: A#B&"ʸQ*\@bg,-ɜ0ˆ|6\,SzpL;5;;5;f
=	f!B(^_CT;Vm@CN]CP}r c`-n,>$o0&UFUH7bi& 
>JCf=&gG R	A&_#uzG%ʌ.55ɀ0saP`|(L
Zm&4%%v7p	K		I	Po`Uo3$N)K))I)@\ S˿{K{{I{j<~3-KI}lά{~`'KIZ6b۱UEKhl<?!?gccDzn%>)	Nv/XRT8DdZkg%m~SS ^o9h+~ee-@ZR`kEO3T 4旙Vt|u|.}2DUj"M=y`'Lz!^zp&	F	˩k""E1Kd
]	;άۼ:r/




8H]PoABEFP	`pl~[kG@8df8250572a93f35fd4250bd6db79d234a45066c0605e2a84f2d1badd6c34ef0f7bded996f27666341569be59ca4c9ea52c224ecb55c7e386e6075d100bba47de4b06d7250b6ae080eabceb99d3b15cc9db8e00c867aff45aaf72d226095d2bfa699bc40670b87e19830e9398289b71507de197cd369605fb40fa3195fe9351a9729b141b81b5e3bf1c114b6ce1a9a4428589278819f2c4978237adf6c6ad74aebaa807934af35e80ee1e4e5d7588e0ca9ce8c2bf0c80bae2163d39f076597a0dbd49b569f1d33296317f2a2b217094c21412238418b5b42f07358ed6fa424cd028e596f754091d2428021872824edcc28af4f578919bd2e6dcb1a3498eb558a6edf05fe3daf7fa15604674a3f764709f2689984fd8da85a9dc3673774b283e20834ca2503208dc1070b6eeb5f603d4e71c434122d0a5a8e15786bed55267a4e8a0dbb4c13cefd4fb617f19cb8f69003221ed9c08945c2ab28eb6bf507f7aec28c78f8dcd5310ed9dce6ec61af172f4c10ccd8c6b3251d369ba57e35532afa4beac72a998a5243bbe4138b53a10c2192595b857e6e1938ea11a25605da6e52f72ad4c54a26b99620eccfa6c25eb9f8678706261623c5da59c92bfb58f5a5860093f3f8f821c01a6be7f48f12c4ed4c66af3c5ca980e97025a48084308b3006f4b7d111078b1d9c6c14f8b91a867567bbef5ac53dacdce5c99fd3c1064cf0ca6bda507e1c26275a57fb9f923ae0c0a6c1fe909f55c8caf41361e19a32e52932abbd1f881500359d9fb022ef8cdbf433640c62c6bb8290a2029a3f60695d49a0c022d8dfabc75ee2c8225dbe0cd0da79726736a78ea85ffeb861fb3b26529fb7c0cb7160ea4beee9109868f76468baada52a6ca46fcccd8b49cab1ccfc29da7965a4a43e7ed8470d5b2e4c2a653c58bcb68d8db1151499ca4053142247c0c067934c738910a441794957f51a80831a0f248ae5a679e3e9f225da451b9e727860e4e4b9329a147f34a1694b7da0581e075c05e8fc30a46d0e68415969c157fb7a65e761eecfa974120f479a7518261f14962b43a2582418d51ec9fcc1d903e2c9259f5ba40f3f77e37e6121141a8b294cd6416f2aa4fd51dda6a549dbb1331e99a5f5dc678b9084e7f13c7ae10c4e70190ab3104153014156469d56c631adbe6ad5ae20e7bd9690ac58d446a4aaf1167e82869e93b81f789e9980b7fa3d11b48c37b363f5bab412fbf81de17af9ada56898c6f787d21570e0633de2bdcd9675b23e0bbf8c71a95152806bf90f8fe8885bf5616682a6b0630473cf3cc07837288763026e8fb6ec4db0a40c39d3766053bbd2b8d415ceb0ec8797cd81602d925c7282937e4164b13d9cfbd1e5f45f39a7c4f5f7eb2ba93809a111ec4f59d35df7ba9de8e64409bfd392872614ebf529cc208ec43adc0e72de3e1ee4c94776a1f99bf9c9498c82bcc8b8469b33d5c3214fe810ba8cd7f4832be2c94a497e31ba116bc672da21b9d9bd57e2591591d175f7fc3b49763b4e04e386934da034c4db8628c827692f3193c8e432b2ba9ced03ad421fcca159392fe1ff65750cd57364243709fd0e3c240b4a0f13de2086249f095078ab70301df34d652484ab0d38ba1d1722a8ec15f772070a4a1a42d003e5d0fda7353b2a8a304f5dc510b6cb66f638a56e786a902edb7ae0c3d83f1b6d38d9de5c42d65bec92a3f76cee95d50f864e7bfea676e506ae77b46682d16d991cbc1f3839c0086ce8295f6d126e0ea52187bb83aecc408c5ecf206894b97d1f15e08ae19bd18f7e2893f0f48737f4626f4c3f48ceda63d7c2be4feb863bed5d78c5b53ef781ad4fce397c070acdb020a1400f66f60afb22aa54cdb9e4434cbc8e114351e35809d314452ea2e479657417415aa044952d7f9e88754a5f2e32cfff7481072ab4b2dbdcdc283640405973e0ed0f5abfe30def799cb8b2c53de07e6d15c57e81917c9faa9e197045fb183d57e809772f0ad9dc6098b7f8871569e6c0e414602829c53018195f6b0038eb7fd3729df1391793c781ae84761a6da44b8e52272f14c609799919706cb2f9b43c734efc8b1db43d19fecd69c2422f5b9934a1e56aff6458fee4156fd318b624276476cad27608a1666dfafa5665dc33a6ee94fffd6b295e36224d34c85cedf1c1787a24ecbba95f34a58925f5fcf82b9f58fcaaa145d74ea8669e2126100061ca09e60e171c8a0a2134794e0713cea9a581fb0f1d74153a6a0a463b48824ebbde620f457ec8df5d076183924deacd3a8dfb7c552692a33f5dc05c29c0114bc46ac1e6e885cc770273dfba3683f01d978a05f0e5e0513b9b7ee2e3d82f54b2285e28cc02909fafe55cf32ca51c6a5a5970f56cb422cecb0720b4032a821dd92eac09bafd80f1949a6dfd25df3d80ab006c83206243c6538c372cfd732bb6deab0af76c2884e348f0653de712177e2056d87be6dbe06ae436a8a2516f9c4726e8bb2e0aa27040a0e479a903e723a38bf0a3dadffade7f638e779fde64aceb7c91b6156da0d1d75951e7a577676bbccc2303554928fe383c5e33ffe6f8921ea12b1c55ebdb89d5a258d8a9cffdaeca6326b1cbbe35c601296e0d3ff7589d6da213de78095582471cbe2c060054606f699a08e360e626a2484beae62e6c1eb21f45a9688ecc37d8e3b8760154979773741bde38f41256aea9b45f3e10b95b268a0e5d8e0964e04ecf7de74a6de4b35bad08f221957ab2a7991a10dd11e3d247983d10f305b5b5f6c5f6214b7669f0a2e65cc236fea8166d51a55dd54k,@,,,leton directory specified in libuser.conf by Python
  admin.createHome and admin.addUser, add parameter skeleton= to admin.addUser
  (#189984)- Fix multilib conflict on libuser.conf.5- New release with updated translations- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Fix crash in lpasswd when user is not specified (#174801)- Avoid using deprecated openldap functions- Rebuild with newer openldap- Support importing of configuration from shadow-utils (/etc/login.defs and
  /etc/default/useradd)
- Add libuser.conf(5) man page- Use gmodule-no-export in the .pc file- Make sure attributes with no values can never appear
- Fix crash in the "files" module when an attribute is missing
- Use hidden visibility for internal functions, remove them from
  libuser/user_private.h; this changes module interface ABI- Permit "portable" user and group names as defined by SUSv3, plus trailing $
  (#159452)
- Don't build static libraries- Rebuild with updated translations, add missing translations.- Allow empty configuration values (#155402)- Ignore nss_compat lines in the "files" module (#154651)
- Autodetect Python version (#154096)
- Add BuildRequires: libselinux-devel, s/BuildPrereq/BuildRequires/- Fix adding objectclasses to existing LDAP entries (#152960)- Add Requires: glib2-devel to libuser-devel (#152501)
- Run ldconfig using %post{,un} -p to let RPM play tricks- Don't silently ignore some I/O errors
- Don't include a Cyrus SASL v1 header file when libldap links to v2 (#150046)
- Rebuild with gcc 4- Important bug fixes in lchage, lgroupmod, lnewusers and lusermod
- Minor bug fixes in lpasswd and luseradd
- Add man pages for the utilities (#61673)- Export UT_NAMESIZE from <utmp.h> to Python (#141273)- Support UID and GID values larger than LONG_MAX (#124967)
- Fix updating of groups after user renaming in lusermod
- Allow setting a shadow password even if the current shadow password is
  invalid (#131180)
- Add lu_{user,group}_unlock_nonempty (#86414); module interface ABI has 
  changed
- Miscellaneous bug and memory leak fixes- rebuild against python 2.4- Make error reporting more consistent, more verbose and always on stderr
  (partly #133861, original patch by Pawel Salek)
- Mark strings previously blocked by string freeze for translation- Fix home directory renaming in ADMIN.modifyUser (#135280)
- Further Python reference counting fixes- Fix memory leaks (#113730)
- Build with updated translations- Fix compilation without libuser headers already installed (#134085)- Allow LDAP connection using ldaps, custom ports or without TLS (original
  patch from Pawel Salek).- Fix freecon() of uninitialized value in files/shadow module- Usable LDAP backend (#68052, #99435, #130404)
- Miscellaneous bug fixes- Don't claim success and exception at the same time (#133479)
- LDAP fixes, second round
- Various other bugfixes- Allow documented optional arguments in Python
  ADMIN.{addUser,modifyUser,deleteUser} (#119812)
- Add man pages for lchfn and lchsh
- LDAP fixes, first round
- Avoid file conflict on multilib systems
- Call ldconfig correctly- Don't attempt to lookup using original entity name after entity
  modification (rename in particular) (#78376, #121252)
- Fix copying of symlinks from /etc/skel (#87572, original patch from gLaNDix)
- Make --enable-quota work, and fix the quota code to at least compile (#89114)
- Fix several bugs (#120168, original patch from Steve Grubb)
- Don't hardcode python version in spec file (#130952, from Robert Scheck)
- Properly integrate the SELinux patch, it should actually be used now, even
  though it was "enabled" since 0.51.7-6- Fix various typos
- Document library interfaces
- Build all shared libraries with -fPIC (#72536)- Update to build with latest autotools and gtk-doc
- Update ALL_LINGUAS and POTFILES.in
- Rebuild to depend on newer openldap- fix is_selinux_enabled call- rebuild against python 2.3
- enable SELinux- Turn off SELinux- Add SELinux support- ldap: set error codes cl.@...()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)mkinitrdrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rpmlib(VersionedDependencies)rtld(GNU_HASH)sh-utils3.3-0.pre3.1.63.el53.0.4-14.0-13.0.3-14.4.2.3Q?Q`L`L`K(JN`J?J}`J	`J	`J	`J	`J	`I6`I`H`H}GF&F`F`FI`FF0`F`FF`Fg.`F]FBD`F@ELE`E`E`E}Et`Et`Et`Et`ESEQE9FE0`E.E`DqDDD+D+D+DpD`DDDbb`D,TC`CC`C֣`C`Cn|C"Bl`B`Bmh`B6	`B,Aa`AQA6F`A4A.]`@q`@@c@@h`@``@Wx@R2@P`@H`@:w@-H@*@`?߀`?.?7`?y?y?se`?\?	`>>`>k>1`>>>]`>Ir`>>`>:>/`>'+`>`>=`=ڴ`=]u===`=<f`<<`<K`<~`<}V<f`<dJ`<_`<Xl<P<GI`<D`<><<
G`<;;8;`;e;~`;H;F4;D`;9;2n`:`:]:`:`:t`:m:h:[:Z8`:X:W`:E `:6:5N`:A:X9@9`9`99`9`99~
9v$9n;9l`9^i9H`969#`9#`9`9`8`8Ҫ8o`8z8`8b8(`8u`87t7#`777`7`7x`7	2`6k6w`66$66g6Q6B6`65(`5I5&`5JE5A`5*5%[5`4c`4V``4O4K`4`4David Shea <dshea@redhat.com> - 3.3-0.pre3.1.63David Shea <dshea@redhat.com> - 3.3-0.pre3.1.62Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.61Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.60.el5_5.1Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.60Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.54Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.53Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.51Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.50Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.49Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.48Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.46Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.46Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.45Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.42Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.41Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.39Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.37Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.34Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.33Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.32Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.31Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.29Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.28Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.27Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.26Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.23Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.21Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.20Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.19Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.18Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.17Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.16Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.15Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.13Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.12Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.11Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.10Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.9Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.8Peter Jones <pjones@redhat.com> - 3.3-0.pre3.1.7Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.6Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.5Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.4Jon Masters <jcm@redhat.com> - 3.3-0.pre3.1.3Jon Masters <jcm@redhat.com> - 3.3-0.pre2.1.3Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4.17Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4.16Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4.15Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4.6Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4.4Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4.3Jesse Keating <jkeating@redhat.com> - 3.3-0.pre1.4.1Jon Masters <jcm@redhat.com> - 3.3-0.pre1.4Harald Hoyer <harald@redhat.com> - 3.3-0.pre1.3Stephen C. Tweedie <sct@redhat.com> - 3.3-0.pre1.2Harald Hoyer <harald@redhat.com> 3.3-0.pre1.1Harald Hoyer <harald@redhat.com> 3.2.2-1Jesse Keating <jkeating@redhat.com> - 3.2-0.pre9.2.2.1Jesse Keating <jkeating@redhat.com> - 3.2-0.pre9.2.2Jesse Keating <jkeating@redhat.com> - 3.2-0Rj`c@q@t of day (Michal Schmidt) [833600]
- [net] sfc: Distinguish crit and non-crit over-temp conditions (Michal Schmidt) [833600]
- [net] sfc: Fix condition for no-op in set_phy_flash_cfg() (Michal Schmidt) [833600]
- [net] sfc: Reduce log level for MCDI error response (Michal Schmidt) [833600]
- [net] sfc: make functions static (Michal Schmidt) [833600]
- [net] sfc: return operator cleanup (Michal Schmidt) [833600]
- [net] sfc: Add support for SFE4003 board and TXC43128 PHY (Michal Schmidt) [833600]
- [net] sfc: Remove support for SFN4111T, SFT9001 and Falcon GMAC (Michal Schmidt) [833600]
- [net] sfc: Fix build due to lack of vmalloc.h include. (Michal Schmidt) [833600]
- [net] sfc: Clean up and correct comments on efx_monitor() (Michal Schmidt) [833600]
- [net] sfc: Fix order of channel_name array dimensions (Michal Schmidt) [833600]
- [net] sfc: Allow changing DMA ring sizes dynamically via ethtool (Michal Schmidt) [833600]
- [net] sfc: Make the dmaq size a run-time setting (Michal Schmidt) [833600]
- [net] sfc: Allocate each channel separately (Michal Schmidt) [833600]
- [net] sfc: Refactor channel and queue lookup and iteration (Michal Schmidt) [833600]
- [net] sfc: Abstract channel and index lookup for RX queues (Michal Schmidt) [833600]
- [net] sfc: Allocate DMA and event rings using GFP_KERNEL (Michal Schmidt) [833600]
- [net] sfc: Fix failure paths in efx_probe_port() (Michal Schmidt) [833600]
- [net] sfc: Remove declarations of functions that no longer exist (Michal Schmidt) [833600]
- [net] sfc: Accumulate RX_NODESC_DROP count in rx_dropped (Michal Schmidt) [833600]
- [net] sfc: avoid some skb->ip_summed initializations (Michal Schmidt) [833600]
- [net] GRO: fix merging a paged skb after non-paged skbs (Michal Schmidt) [833600]
- [fs] ext3: pass custom EOF to generic_file_llseek_size() (Eric Sandeen) [784191]
- [fs] ext4: use core vfs llseek code for dir seeks (Eric Sandeen) [784191]
- [fs] vfs: allow custom EOF in generic_file_llseek code (Eric Sandeen) [784191]
- [fs] ext4: return 32/64-bit dir name hash according to usage type (Eric Sandeen) [784191]
- [fs] ext4: improve llseek error handling for large seek offsets (Eric Sandeen) [784191]
- [fs] ext3: return 32/64-bit dir name hash according to usage type (Eric Sandeen) [784191]
- [s390/ppc64] add is_compat_task() for s390 and ppc64 (Eric Sandeen) [784191]
- [fs] vfs: add generic_file_llseek_size (Eric Sandeen) [784191]
- [fs] nfsd: vfs_llseek() with 32 or 64 bit offsets (hashes) (Eric Sandeen) [784191]
- [fs] nfsd: rename 'int access' to 'int may_flags' in nfsd_open() (Eric Sandeen) [784191]
- [fs] add new FMODE flags: FMODE_32bithash and FMODE_64bithash (Eric Sandeen) [784191]
- [fs] nfsd4: Remove check for a 32-bit cookie in nfsd4_readdir() (Eric Sandeen) [784191]
- [net] cxgb3: unify return value of .ndo_set_mac_address (Jay Fenlason) [802609]
- [net] cxgb3: update firmware version (Jay Fenlason) [802609]
- [net] cxgb3: Handle NULL dst neighbour in cxgb3_offload.c (Jay Fenlason) [802609]
- [net] cxgb3: Rework t3_l2t_get to take a dst_entry (Jay Fenlason) [802609]
- [net] cxgb3: remove inadvertently added rejects from last update (Jay Fenlason) [802609]
- [net] cxgb3: Remove N/A fw_version dustbunnies from .get_drvinfo (Jay Fenlason) [802609]
- [net] cxgb3: Use strcpy in .get_drvinfo routines (Jay Fenlason) [802609]
- [net] cxgb3: add skb frag size accessors (Jay Fenlason) [802609]
- [net] cxgb3:  Remove zero assignments of ethtool_ringparam fields (Jay Fenlason) [802609]
- [net] igb: rework igb_poll to better match upstream (Stefan Assmann) [837347]- [x86_64] cpa: Fix missing TLB flush problem in change_page_attr() (Frank Arnold) [818333]
- [block] loop: prevent information leak after failed read (Dave Young) [761416]
- [char] ipmi: decrease IPMI message trans time in interrupt mode (Shyam Iyer) [797052]
- [net] qlge: Bumped driver version to 1.00.00.30. (Chad Dupuis) [796738]
- [net] qlge: Fix memory leak in the process of refill (Chad Dupuis) [796738]
- [net] qlge: Fixed invalid reference to ip header (Chad Dupuis) [796738]
- [nj(Q@ (Jeff Burke ) [220069]
- [gfs2] corrrectly display revalidated directories (Robert Peterson ) [222302]
- [gfs2] fix softlockups (Josef Whiter ) [229080]
- [gfs2] occasional panic in gfs2_unlink while running bonnie++ (Steven Whitehouse ) [229831]
- [gfs2] Shrink gfs2 in-core inode size (Steven Whitehouse ) [230693]
- [GFS2] Fix list corruption in lops.c (Steven Whitehouse ) [226994]
- [gfs2] fix missing unlock_page() (Steven Whitehouse ) [224686]
- [dlm] make lock_dlm drop_count tunable in sysfs (David Teigland ) [224460]
- [dlm] increase default lock limit (David Teigland ) [224460]
- [dlm] can miss clearing resend flag (David Teigland ) [223522]
- [dlm] fix master recovery (David Teigland ) [222307]
- [dlm] fix user unlocking (David Teigland ) [219388]
- [dlm] saved dlm message can be dropped (David Teigland ) [223102]- [x86_64] Don't leak NT bit into next task (Dave Anderson ) [213313]
- [mm] Gdb does not accurately output the backtrace. (Dave Anderson ) [222826]
- [net] IPV6 security holes in ipv6_sockglue.c - 2 (David S. Miller ) [231517] {CVE-2007-1000}
- [net] IPV6 security holes in ipv6_sockglue.c (David S. Miller ) [231668] {CVE-2007-1388}
- [audit] GFP_KERNEL allocations in non-blocking context fix (Alexander Viro ) [228409]
- [NFS] version 2 over UDP is not working properly (Steve Dickson ) [227718]
- [x86] Fix various data declarations in cyrix.c (Prarit Bhargava ) [226855]
- [sound] Fix various data declarations in sound/drivers (Prarit Bhargava ) [227839]
- [mm] remove __initdata from initkmem_list3 (Prarit Bhargava ) [226865]- [xen] move xen sources out of kernel-xen-devel (Don Zickus ) [212968]
- [net] __devinit & __devexit cleanups for de2104x driver (Prarit Bhargava ) [228736]
- [video] Change rivafb_remove to __deviexit (Prarit Bhargava ) [227838]
- [x86] Reorganize smp_alternatives sections in vmlinuz (Prarit Bhargava ) [226876]
- [atm] Fix __initdata declarations in drivers/atm/he.c (Prarit Bhargava ) [227830]
- [video] Change nvidiafb_remove to __devexit (Prarit Bhargava ) [227837]
- [usb] __init to __devinit in isp116x_probe (Prarit Bhargava ) [227836]
- [rtc] __init to __devinit in rtc drivers' probe functions (Prarit Bhargava ) [227834]
- [x86] remove __init from sysenter_setup (Prarit Bhargava ) [226852]
- [irq] remove __init from noirqdebug_setup (Prarit Bhargava ) [226851]
- [x86] remove __init from efi_get_time (Prarit Bhargava ) [226849]
- [x86] Change __init to __cpuinit data in SMP code (Prarit Bhargava ) [226859]
- [x86] apic probe __init fixes (Prarit Bhargava ) [226875]
- [x86] fix apci related MODPOST warnings (Prarit Bhargava ) [226845]
- [serial] change serial8250_console_setup to __init (Prarit Bhargava ) [226869]
- [init] Break init() into two parts to avoid MODPOST warnings (Prarit Bhargava ) [226829]
- [x86] declare functions __init to avoid  compile warnings (Prarit Bhargava ) [226858]
- [x86] cpu hotplug/smpboot misc MODPOST warning fixes (Prarit Bhargava ) [226826]
- [x86] Fix boot_params and .pci_fixup warnings (Prarit Bhargava ) [226824 226874]
- [xen] Enable Xen booting on machines with > 64G (Chris Lalancette ) [220592]
- [utrace] exploit and unkillable cpu fixes (Roland McGrath ) [229886]
- [pcmcia] buffer overflow in omnikey cardman driver    (Don Howard ) [227478]- [cpufreq] Remove __initdata from tscsync (Prarit Bhargava ) [223017]
- [security] Fix key serial number collision problem (David Howells ) [227497] {CVE-2007-0006}
- [fs] core dump of read-only binarys (Don Howard ) [228886] {CVE-2007-0958}- enable debug options- quiet down the console_loglevel (Don Zickus) [224613]- xen: fix TLB flushing in shadow pagetable mode (Rik van Riel ) [224227]- Update: xen: Add PACKET_AUXDATA cmsg (Herbert Xu ) [223505]- x86: /proc/mtrr interface MTRR bug fix (Bhavana Nagendra ) [223821]
- Revert: bonding: eliminate rtnl assertion spew (Andy Gospodarek ) [210577]
- ia64: Check for TIO errors on shub2 Altix (George Beshers ) [223529]
- nfs: Unable to mount more than 1 Secure NFS mount (Steve Dickson ) [220649]- IPSec: incorrect return code in xfrmj0_{@
- [scsi] mptsas: enable TLR for SSP TAPE drives (Tomas Henzl) [599420]
- [scsi] sas: add transport layer retry support (Tomas Henzl) [599420]
- [scsi] fix potential kmalloc failure in scsi_get_vpd_page (Tomas Henzl) [599420]
- [scsi] fix bugs in scsi_vpd_inquiry (Tomas Henzl) [599420]
- [scsi] add VPD helper (Tomas Henzl) [599420]
- [x86_64] implement vDSO randomization (Danny Feng) [459763]
- [virt] xen: don't adjust time for ntp clock slowing (Bretislav Kabele) [553407]
- [net] ibmveth: fix lost IRQ that leads to service loss (Steve Best) [626841]
- [scsi] cxgb3i: sync driver with upstream for RHEL5.6 (Mike Christie) [567444]
- [net] sched: fix some kernel memory leaks (Jiri Pirko) [624638] {CVE-2010-2942}
- [tpm] autoload tpm_tis driver (John Feeney) [530123]
- [usb] fix usbfs information leak (Eugene Teo) [566629] {CVE-2010-1083}
- [virtio] console: Backport driver for RHEL 5.6 (Amit Shah) [620037]
- [virtio] add virtqueue_ vq_ops wrappers (Amit Shah) [620037]
- [virtio] initialize vq->data entries to NULL (Amit Shah) [620037]
- [virtio] add ability to detach unused buffers from vrings (Amit Shah) [620037]
- [virtio] make add_buf return capacity remaining (Amit Shah) [620037]
- [virtio] find_vqs/del_vqs virtio operations (Amit Shah) [620037]
- [virtio] add names to virtqueue struct (Amit Shah) [620037]
- [virtio] more neatening of virtio_ring macros (Amit Shah) [620037]
- [virtio] fix BAD_RING, START_US and END_USE macros (Amit Shah) [620037]- [mm] pass correct mm when growing stack (Jiri Pirko) [607858] {CVE-2010-2240}
- [mm] fix up some user-visible effects of stack guard page (Jiri Pirko) [607858] {CVE-2010-2240}
- [mm] fix page table unmap for stack guard page properly (Jiri Pirko) [607858] {CVE-2010-2240}
- [mm] fix missing unmap for stack guard page failure case (Jiri Pirko) [607858] {CVE-2010-2240}
- [mm] keep a guard page below a grow-down stack segment (Jiri Pirko) [607858] {CVE-2010-2240}
- [net] tcp: fix div by zero in congestion control protos (Neil Horman) [608641]
- [net] tcp: tcp_vegas ssthresh bug fix (Thomas Graf) [612709]
- [net] tcp: tcp_vegas cong avoid fix (Thomas Graf) [612709]
- [net] tcp: fix overflow bug in Vegas (Thomas Graf) [612709]
- [net] tcp: fix Vegas bug in disabling slow start (Thomas Graf) [612709]
- [net] tcp: increase Vegas default alpha and beta params (Thomas Graf) [612709]
- [net] tcp: tcp_hybla zero congestion window growth fix (Thomas Graf) [612709]
- [net] tcp: htcp last_cong bug fix (Thomas Graf) [612709]
- [net] tcp: TCP cubic v2.2 (Thomas Graf) [612709]
- [net] tcp: faster cube root (Thomas Graf) [612709]
- [net] tcp: backport cubic update for net-2.6.22 (Thomas Graf) [612709]
- [net] tcp: set Cubic and BIC default thresholds to zero (Thomas Graf) [612709]
- [net] tcp: congestion control initialization (Thomas Graf) [612709]
- [net] tcp: uninline tcp_is_cwnd_limited (Thomas Graf) [612709]
- [net] tcp: move prior_in_flight collect to better spot (Thomas Graf) [612709]
- [fs] ext4: consolidate in_range definitions (Eric Sandeen) [624332] {CVE-2010-3015}
- [net] don't double count UDP_INERRORS (Neil Horman) [618818]
- [scsi] be2iscsi: sync with upstream for RHEL5.6 (Mike Christie) [569643]
- [mmc] sdhci: fix system cannot enter S4 with SD card (Matthew Garrett) [606899]
- [cpufreq] powernow-k8: support AMD Core Performance Boost (Matthew Garrett) [568751]
- [fs] cifs: remove force parm from cifs_unix_info_to_inode (Jeff Layton) [619112]
- [fs] nfs: fix NFS4ERR_FILE_OPEN handling in Linux/NFS (Jeff Layton) [604044]
- [usb] fix test of wrong variable in create_by_name (Don Howard) [594635]
- [s390] cio: fix cause of unexpected recovery actions (Hendrik Brueckner) [621330]- [ipmi] add parameter to limit CPU usage in kipmid (Takao Indoh) [494680]
- [net] bnx2x: Added GRO support (Stanislaw Gruszka) [573114]
- [net] bnx2x: fix memory barriers (Stanislaw Gruszka) [569370]
- [ppc] partition hibernation support (Steve Best) [565570]
- [ppc] Add resume handler to powerpc time management code (Steve Best) [565570]
- [scsi] ibmvscsi: Fix soft lockup on resuk?--@--,-.-otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibxml2-2.6.26-2.1.25.el5_11.src.rpmlibxml2-devel@@@JJ/bin/sh/usr/bin/pythonlibxml2libxml2.so.2()(64bit)pkgconfigrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)zlib-devel2.6.263.0.4-14.0-14.4.2.3TjoQQ#QPPG`P5V`P4O9O5`OnN`N
NMLN`Jx`IQHHH`Gf`DpDpDpDL`DDDaniel Veillard <veillard@redhat.com> - 2.6.26-2.1.25.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.24.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.23.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.22.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.21.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.20.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.19.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.18.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.17.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.16.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.15.el5Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.14Daniel Veillard <veillard@redhat.com> - 2.6.26-2.1.13Daniel VeikL@4c1fd234daba593be89bf44b489a5fe32f0b9ce6e721a1024cf03590ccc57f5c43f5832956246cb4d88e6b50c8d7514cc965adf5c5a603bdbb95f0c436a73fbdd0f1fb9da2a1279dcd7920ffbb592fe5d78d7d2a1310a259bfeb24b3659eb5c3643f58a0c04eb6860f044fbee0294651e522ce7d6bedff23ce1522c162fe5b5f49760beeff99aafa2610de8b6c03cb461c9f697f6c57b337d70510ae8d7b66920d5c043a8f9e9af6881dc9666129a8c35d9f94289406cd082fd3ed00e02df16fc4d4a3816178066451167360799475dafe1267fe550d41c27e475da0f5701521efa6979584f20906c68857e834d2f1bc73582e98c4324b13e88e8adfa88895aab8e2f1ec29052c718fd04111a3b0b92726a76c5afa8d3cc092866b13ff63b4df50415b8e73bb5438c579ce0de4caa82947e0d05c2308a88ae8e5e9bbe2a52102b1447398a60d9a9e11558f7a82a97c3c060a288101256505da465b86154405555c157f6f9af0445bcf64a4e0c132e474c7d825384ed7d447142fac632588ae12ace0efc9bba2c5e14cfddc6700b5a51a661cf90d98ee24d2c0417862faf0a9d773c31dceb4f87a492fdb1daaacf2867ac10b64ad986e5241ef5a628cfa38b3f1a16a0efb9f55a5e669afd8774ccbdf329262f278688382d737cbfdff4d7a146b936f61768c9b588f782f5f1f7e193e1e802eb8f9c1e7090871c6c4ce5db285a31a643dd6f3ce81c82a5a4322a6df363cb8fa39a7d77d5cee375a6b1c4613ba707496e018001a39094d9c6a46ba25d8fa550a38839232eb7cedd067be0b0b9034dd52d81d2fc8ac52a9b859cc013f5273fc6aa1577f5cc6099ee831b9a39c65e89bb599f7ab82024d426f7a6839b0b314a70dff80c989c863b036582501bbf840c078b77c605874d9d820c84313411f8154b7f75d6422fdbc22a385e901d70f3b22155d9c980e8b680d71648ff36550d1f9885cdccf3f6c56b429c7bb85a8c2f9088441abbdfb73be8796a2f79ba3e4fa4a728c3929e46db0bebd485de6c0c2bae6556fc94535022a82293ccad8e33d95868334badd7280112382e6ea7a346115b037c9803fb6392da9d9ace05c24da028eb037e35662ac8ccabcd078af3af66ecb59808c0ffe85ceede71926e261e13a44f1033045dd1c4a77da9fc92e50e6d81856f3ef70678390fbba1f270ac31b1f6d02f43d4923e038ac8a8b40be3c4eb5a456d8a2dbd67353de6fba1f6bfcfc15f0c0738a72f0cb0916a89b5f9e7beae4af5cdae7b9ef486bb3ce788ee518bf7c2903c63b48398972fc5eac72bcd8a09a92cf138330cd480f27e13f62fa8dd56779ee5ca73ea6a5cedd8d7b723978dee2c6d29c18b9bf8a76f7a9173afef13fd14e282ece4a77bfae75ea14babe801e2267e4591c8edcd97dd251ae26c0956e44bfc6be3f145a3bc91e1edff782c5ca67ad9e40c1ade320524f6aefc8cd08ebc6731ae2c55bd44599fab4fd7c192a7bb1c225ea65438625f2126c8c6d70cbc72843b034a3f9ab675aa8b0bedcd142cd1969cad6be38fcf9f432ad8d799ddf7cfcd2175c5f740deceb4e0401fac70228d1648dcc61d82237f02a7ffe33d7f672403a8cbe7d43b3c6202db004861bc70e7bb9c628a9dcfc8f0746e9c1178f70e82167a2c9b3c804c7b1dda95b6a9be3b05260933ac4c4e47d25579169ab785c1b5a7dbc71d50bb45e95611502d8110aa5df689352ee4cca50fba8e41a8c8cd0a5658955c96165c689e00c209fb5d50adb3e2c6349b85e548a88c0922373f845b9b13ac964eac321ca2406305552b363a93b68d632a440a0da259f6159f074b162ac8ebcfd0f5691681eb222bd787a20cf4ac585d8ebafd048391977e0a0f0c0c1fafd49e7df26449e12ae3a7bda8a6a9e2f1f2fd6a1977dae5220a5fc2db2b2ec9b0d563f181b36b9a4413be3bd47ead02acfea4bca0269578cc42e7b8f7af60e39d2105a4de3b971eca2de440af9adbb3c9b9a86729bd23f24dd6ef8649f9e36674565fac1a20a986fbedbb617aada8ed22f685e92af19b572be27c4320e81c39cfd611fb6b3f72975def99e5cdb87a985e562408d27defcb7eda27525313c3777c100c166951a4e68c93801203e3135f1a4cf923deae5675d13839756bdfdbacfdee97e9129887336242e80cbb3e258c36e6e5ccc68c89c68cb52e7193824f396c7091564d1550922d38f0462a54e4736fab326987d9dbdca695e6cf18d13de38274ed321c85242022c392adef22a37a58a22337344a1d8721dcd2f8e2dbfb0381b958066ada4b37afcba2ce2a2c1e05be851fa40d0a2f8cde6eaa526e0607e8aba7b494437b5edd3bf39cf6ce88f7a2efcc393659f8a2d8ffb123de903c1338f812e3d16bf4da47c1e95613662e703fd7d2738a692d797d9d687e1f7a87ef609e61d4f2e1bb4cc7af83c8eb04db2d8c425d9f0c0666a1ccb5e40c9ddfcf21f71ef124f36728d781d9a3662d66456d8f56e596e3877b4e91330c02c5c508652646c807964ad9ce35405aa3b40bcfad651463f360888de043bbef9c81b876e11ff6ab862974219fe40c49c81bb178ea2630784563315f94c05082067f7b7d9badb694af73a718b6b17b7a9a0ea539e6383222748970139f2f252afa406ca88a40fbb2bfd18132319b680416bd06244f197df2aa5129ba5043432a74764c7e29bd00253e8531ec4026e8c06db0351e79d7d1293eefadb6c84dda708e2b95593b7b96b41bb57a39985b7e28b097eb4c1118c70208e88b45a03efc03efa99716d17bb47482e7df9jPO@list (Herbert Xu) [552574]
- [net] gro: fix bogus gso_size on the first fraglist entry (Herbert Xu) [588015]
- [time] fix softlockups in RHEL5 virt guests (Glauber Costa) [607443]
- [time] count ticks when loss gt cycle_accounted_limit (Glauber Costa) [584679]
- [net] e1000e: don't inadvertently re-set INTX_DISABLE (Dean Nelson) [496127]
- [scsi] fixup size on read capacity failure (David Milburn) [569654]
- [s390] smsgiucv: add missing check for z/VM (Hendrik Brueckner) [590737]
- [s390] zcore: fix reipl device detection (Hendrik Brueckner) [587027]
- [s390] zcrypt: print error message for 8/72 error (Hendrik Brueckner) [563545]
- [s390] kernel: fix dump indicator (Hendrik Brueckner) [546288]
- [net] bluetooth: fix possible bad memory access via sysfs (Mauro Carvalho Chehab) [576021] {CVE-2010-1084}- [scsi] ipr: adds PCI ID definitions for new adapters (Steve Best) [563589]
- [scsi] ipr: add support for new IOASCs (Steve Best) [563589]
- [scsi] ipr: add support for multiple stages of init (Steve Best) [563589]
- [scsi] ipr: implement shutdown changes (Steve Best) [563589]
- [scsi] ipr: hardware assisted smart dump functionality (Steve Best) [563589]
- [scsi] ipr: add error handling updates for next gen chip (Steve Best) [563589]
- [scsi] ipr: update the config table for next gen chip (Steve Best) [563589]
- [scsi] ipr: define register offsets for next gen chip (Steve Best) [563589]
- [scsi] ipr: add command structures for next gen chip (Steve Best) [563589]
- [scsi] ipr: differentiate pci-x and pci-e based adapters (Steve Best) [563589]
- [scsi] ipr: add test for MSI interrupt support (Steve Best) [563589]
- [scsi] ipr: add message to error table (Steve Best) [563589]
- [scsi] ipr: handle logically bad block write errors (Steve Best) [563589]
- [scsi] ipr: convert to use the data buffer accessors (Steve Best) [563589]
- [scsi] ipr: add some defines that are missing in RHEL5.5 (Steve Best) [563589]
- [scsi] ipr: add workaround for MSI interrupts on P7 (Steve Best) [572333]
- [net] tcp: fix rcv mss estimate for lro (Stanislaw Gruszka) [593801]
- [virt] xen netback: copy skbuffs if head crosses pages (Paolo Bonzini) [578259]
- [virt] xen: handle softirqs at end of event processing (Paolo Bonzini) [564523]
- [virt] fix tsccount clocksource under kvm guests (Glauber Costa) [581396]
- [net] benet: compat header cleanups, part 2 (Ivan Vecera) [546740]
- [net] benet: compat header cleanups, part 1 (Prarit Bhargava) [546740]
- [net] bnx2: compat header cleanups (Prarit Bhargava) [546740]
- [net] e1000/e1000e: compat header cleanup (Prarit Bhargava) [546740]
- [net] enic: compat header cleanup (Prarit Bhargava) [546740]
- [net] forcedeth: compat header cleanup (Prarit Bhargava) [546740]
- [net] igb: compat header cleanups (Prarit Bhargava) [546740]
- [net] ixgbe: compat header cleanups (Prarit Bhargava) [546740]
- [net] myri10ge: compat header cleanups (Prarit Bhargava) [546740]
- [net] netxen: compat header cleanup (Prarit Bhargava) [546740]
- [net] niu: compat header cleanup (Prarit Bhargava) [546740]
- [net] qlge: compat header cleanup (Prarit Bhargava) [546740]
- [net] r8169: compat header cleanups, part 2 (Ivan Vecera) [546740]
- [net] r8169: compat header cleanups, part 1 (Prarit Bhargava) [546740]
- [net] sfc: compat header cleanups (Prarit Bhargava) [546740]
- [net] sky2: compat header cleanup (Prarit Bhargava) [546740]
- [net] tg3: compat header cleanup (Prarit Bhargava) [546740]
- [net] bonding: compat header cleanup (Prarit Bhargava) [546740]
- [net] move compat header file contents to proper includes (Prarit Bhargava) [546740]
- [net] ethernet: compat header cleanups (Prarit Bhargava) [546740]
- [net] chelsio: compat header cleanups (Prarit Bhargava) [546740]
- [net] s2io: compat header cleanups (Prarit Bhargava) [546740]
- [net] vxge: compat header cleanup (Prarit Bhargava) [546740]
- [infiniband] compat header cleanups (Prarit Bhargava) [546740]
- [scsi] compat header cleanups (Prarit Bhargava) [546740]
- [misc] readq/writeq compat header cleanup (Prarit Bhargava) [546740]
- [pci] compat hju0@eader cleanups (Prarit Bhargava) [546740]
- [misc] compat.h cleanup: add cancel_delayed_work_sync (Prarit Bhargava) [546740]
- [i2c] compat header cleanups (Prarit Bhargava) [546740]
- [fs] nfs: fix memory leak when using -onolock on nfs v2/3 (Jeff Layton) [592908]- [fs] gfs2: fix ordering of ordered writes (Steven Whitehouse) [581013]
- [net] cnic: fix bnx2x panic w/multiple interfaces enabled (Stanislaw Gruszka) [602402]
- [x86_64] unify apic mapping code (Prarit Bhargava) [573858]
- [virt] xen: fix Connected state after netback dev closed (Paolo Bonzini) [591548]
- [net] ipv4: add sysctl to accept packets w/local source (Jiri Olsa) [601370]
- [nfs] fix unitialized list head on error exit in recovery (Jeff Layton) [569342]
- [virt] virtio_blk: add support for cache flushes (Christoph Hellwig) [571735]
- [xen] ia64: unset be from the task psr (Andrew Jones) [587477] {CVE-2010-2070}- [misc] permit larger than 2TB USB and FW drives (Pete Zaitcev) [503864]
- [net] cnic: fix panic when nl msg rcvd when device down (Stanislaw Gruszka) [595862]
- [infiniband] ehca: require in_wc in process_mad (Steve Best) [571517]
- [net] igb: Add support for pci-e Advanced Error Reporting (Stefan Assmann) [568221]
- [fs] ext4: MOVE_EXT can't overwrite append-only files (Eric Sandeen) [601008] {CVE-2010-2066}
- [net] wireless: convert reg_regdb_search_lock to mutex (John Linville) [597334]
- [net] tcp: don't send keepalive probes if receiving data (Flavio Leitner) [593040]
- [hwmon] add support for additional CPU models to coretemp (Dean Nelson) [559228]
- [fs] gfs2: use -EUSERS when mounting w/o enough journals (Abhijith Das) [600387]
- [misc] workqueue: make cancel_work_sync EXPORT_SYMBOL_GPL (Oleg Nesterov) [596626]- [fs] gfs2: fix permissions checking for setflags ioctl (Steven Whitehouse) [595399] {CVE-2010-1641}
- [mm] clear page errors when issuing a fresh read of page (Rik van Riel) [590763]
- [misc] keys: do not find already freed keyrings (Vitaly Mayatskikh) [585100] {CVE-2010-1437}
- [misc] workqueue: silence kabi checker (Stanislaw Gruszka) [596626]
- [misc] workqueue: implement cancel_work_sync (Oleg Nesterov) [596626]
- [misc] workqueue: implement try_to_grab_pending (Oleg Nesterov) [596626]
- [misc] workqueue: prep flush_cpu_workqueue for additions (Oleg Nesterov) [596626]
- [misc] workqueue: implement wait_on_work (Oleg Nesterov) [596626]
- [misc] workqueue: add set_wq_data and get_wq_data helpers (Oleg Nesterov) [596626]
- [misc] workqueue: cwq instead of wq where appropriate (Oleg Nesterov) [596626]
- [misc] workqueue: initial prep for cancel_work_sync (Oleg Nesterov) [596626]
- [net] sctp: file must be valid before setting timeout (Jiri Pirko) [578261]
- [net] tg3: fix panic in tg3_interrupt (John Feeney) [569106]
- [net] e1000/e1000e: implement simple interrupt moderation (Andy Gospodarek) [586416]
- [virt] don't compute pvclock adjustments if we trust tsc (Glauber Costa) [570824]
- [virt] add a global synchronization point for pvclock (Glauber Costa) [570824]
- [virt] enable pvclock flags in vcpu_time_info structure (Glauber Costa) [570824]
- [misc] add atomic64_cmpxcgh to x86_64 include files (Glauber Costa) [570824]
- [x86] grab atomic64 types from upstream (Glauber Costa) [570824]
- [pci] cleanup error return for pcix get/set mmrbc calls (Dean Nelson) [578492]
- [pci] fix pcix access of PCI_X_CMD get/set mmrbc calls (Dean Nelson) [578492]
- [pci] fix return value from pcix_get_max_mmrbc() (Dean Nelson) [578492]
- [pci] prepare for backport of upstream fixes and cleanup (Dean Nelson) [578492]
- [net] ipv6: fix more memory leaks when ndisc_init fails (Amerigo Wang) [555338]
- [xen] bring back VMXE/SVME flags (Andrew Jones) [570091]- [s390] qdio: continue polling for buffer state ERROR (Hendrik Brueckner) [565531]
- [pci] acpiphp: fix missing acpiphp_glue_exit (Prarit Bhargava) [515556]
- [net] cnic: Fix crash during bnx2x MTU change (Stanislaw Gruszka) [582367]
- [net] bxn2x: add dynamic lro disable support (Stanislaw Gruszka) [582367]
- [net] implement dev_disable_lro api for RHEL5 (StanisikA@AB@



	



	

	



RRR	R
RR
RRRRRRPRRR
RRRRPRRR
RRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR
RRRRPRRR
RRRRP	RRR
R
RRRRP
RRR
RR
RRRRPRRR
RRRRPRRR
RRRRP
RRR	R
RR
RRRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR
R
RRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR
R
RRRRPRRR
RR
RRRRPRRR	R
RR
RRRRPRRR	R
RR
RRRRPRRR
RRRRPRRR
RR
RRRRPRRR
RR
RRRRPRRR	R
RR
RRRRPRRR
RR
RRRRskd	@d	e	y~

	RRRRRRRR R$R(RRRRRRRR R$R(RRRR
RRRRRRRRRRRRRRRRR$R'R)R,R-RRRR
RRRRRRRRRRRRRRRRR$R'R)R,R-PR	RR#R-R.PR	RR#R$R-R.PRR#R,R-R.PR#R-R.PRRR#R-R.PR
RR-R.PRRR#R%R&R(R*R+R-R.PR	R#R$R-R.PRRRR-P	RR-P
PRRRRR#R,R-R.PRRR
RRRRRR#R-R.P
RRRR#R,R-R.PPR
RR#R-R.PRRRR#R-R.PRRR
RRRRRRRR#R-R.PRR-PR#R-R.PRRRRR!R"R#R$R*R-R.RRRRRRRRRRRRR? nB왞ss?TGV(\@_ysrd2c>B"o)?l|>TGV(%16A\OKX.b3y.}UK%A؅g32974f279b6f02a941dec2f853ae86a617a9aa88\<\</18698, c++/26577, c++/27019,
	c++/27424, c++/27768, c++/27820, c++/28114, fortran/23420,
	fortran/23862, fortran/24748, fortran/26801, fortran/27965,
	fortran/28081, fortran/28094, fortran/28167, fortran/28174,
	fortran/28213, fortran/28237, middle-end/27428, target/28084,
	target/28207, tree-optimization/28218
- use --hash-style=gnu by default
- C++ visibility fixes (Jason Merrill, PRs c++/17470, c++/19134,
  c++/21581, c++/21675, c++/25915, c++/26612, c++/26905, c++/26984,
  c++/27000, c++/28215, c++/28279)
- fix ppc insvdi_internal2/3 (David Edelsohn, Alan Modra, #197755,
  PR target/28170)
- avoid TFmode PRE_INC/PRE_DEC on ppc (David Edelsohn, PR target/28150)- update from gcc-4_1-branch (-r114766:115058)
  - PRs c++/27821, c++/28109, c++/28110, c++/28112, fortran/16206,
	fortran/18769, fortran/19310, fortran/19904, fortran/20867,
	fortran/20874, fortran/20876, fortran/22038, fortran/25049,
	fortran/25050, fortran/25056, fortran/25073, fortran/27554,
	fortran/27715, fortran/27784, fortran/27895, fortran/27958,
	fortran/28118, fortran/28119, libfortran/27784, libfortran/27895,
	libgcj/28178, middle-end/28045, middle-end/28151, target/27082,
	target/27861, tree-optimization/27781
- fix a reload problem that lead sometimes to writes to read-only objects
  (Bernd Schmidt, #196736, PR middle-end/26991, PR rtl-optimization/25636)
- ppc -mcpu=power6 initial support (Pete Steinmetz, #195924)- fix C++ #pragma omp atomic (Mark Mitchell)- update from gcc-4_1-branch (-r114555:114766)
  - PRs bootstrap/22541, c++/21210, c++/26559, c++/27227, c++/27648,
	c++/27665, c++/27666, c++/27689, c++/27884, c++/27933, c++/27951,
	fortran/27786, java/28024, middle-end/27733, middle-end/27802,
	target/27858, tree-optimization/27830
- merge gomp changes from the trunk (-r114642:114643)
  - PR libgomp/28008
- fix -fmerge-all-constants
- fix #pragma omp critical handling if not !l0@000 GCC 4.0- Update to 2.9.3- Update to 2.6.5- Update to 2.6.4- Update to 2.6.3- fix an translation problem- update to 2.6.2- Update to 2.6.1- rebuilt- update to 2.6.0- Fix requirements- update to 2.5.90- rebuilt- update to 2.5.6- rebuilt- update to 2.5.3- Fix g_strdup_printf usage in info2html (bug #111200, patch from
  Miloslav Trmac).- update to 2.4.0 (only code change is bugfix from me)
- Fixed the utf8 manpage patch (#91689)- info and manpages are utf8- Update for gnome 2.3- Rebuild- update to 2.2.3- rebuilt- fix buildrequires- rebuilt- Update to 2.2.0
- Add libglade dependency- Updated to 2.1.4- rebuild for all arches- Remove the strange copyright on the start page. Fixes #69106- 1.0.2
- include libexecdir stuff- rebuild with new gail
- 1.0.1- automated rebuild- put all the binaries in the file list... why is this package so hard?- put images in file list, this thing will be non-ugly yet- 1.0
- use desktop-file-install to install/munge .desktop files
- put the sgml stuff in file list- rebuild in different environment- 0.10- automated rebuild- rebuild in different environment- 0.8- 0.6.1- 0.6- Rebuild for new gnome2 libraries- Initial build./bin/sh/bin/sh/bin/sh/bin/shbuilder10.centos.org 1361324851	!$'*-0369<?BEHKNQTWZ]`cfilorux{~afamarazbebgbnbnbrbscacscydadedzeleneneoeseteufafifrgaglguhehihrhuidisitjakaknkokukyliltlvmkmlmnmrmsnbnds@NFEnenlnnnsoorpaplptptrorurwskslsqsrsr@Latnsvtatgthtrugukviwaxhzhzhzhzu2.16.0-30.el5_9	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[[\\\\\\\\\\[[[[[[]]][^^^^^^^[yelp.schemasgnome-helpyelpgnome-yelp.desktophicolor192x192appsyelp-icon-big.pngyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelp.moyelpdefault.cssiconsyelp-icon-caution.pngyelp-icon-important.pngyelp-icon-note.pngyelp-icon-tip.pngyelp-icon-warning.pngyelp-watermark-blockquote-00AB.pngyelp-watermark-blockquote-00BB.pngyelp-watermark-blockquote-201C.pngyelp-watermark-blockquote-201D.pj@et] ipv6: fix OOPS in ip6_dst_lookup_tail (Thomas Graf) [552354]
- [misc] khungtaskd: set PF_NOFREEZE flag to fix suspend (Amerigo Wang) [550014]
- [block] loop: fix aops check for GFS (Josef Bacik) [549397]- [misc] EDAC driver fix for non-MMCONFIG systems (Bhavna Sarathy) [550123]
- [misc] audit: fix breakage and leaks in audit_tree.c (Alexander Viro) [549750]
- [mm] prevent hangs during memory reclaim on large systems (Larry Woodman) [546428]
- [usb] support more Huawei modems (Pete Zaitcev) [517454]
- [x86] fix AMD M-C boot inside xen on pre-5.5 hypervisor (Paolo Bonzini) [560013]
- [kvm] pvclock on i386 suffers from double registering (Glauber Costa) [557095]
- [md] fix kernel panic releasing bio after recovery failed (Takahiro Yasui) [555171]
- [md] fix deadlock at suspending mirror device (Takahiro Yasui) [555120]
- [pci] VF can't be enabled in dom0 (Don Dutile) [547980]
- [acpi] fix NULL pointer panic in acpi_run_os (Prarit Bhargava) [547733]
- [kvm] kvmclock won't restore properly after resume (Glauber Costa) [539521]
- [x86_64] export additional features in cpuinfo for xen (Prarit Bhargava) [517928]
- [fs] proc: make smaps readable even after setuid (Dave Anderson) [322881]
- [net] iptables: fix routing of REJECT target packets (Jiri Olsa) [548079]
- [net] niu: fix the driver to be functional with vlans (Jiri Pirko) [538649]
- [mm] prevent performance hit for 32-bit apps on x86_64 (Larry Woodman) [544448]
- [mm] mmap: don't ENOMEM when mapcount is temp exceeded (Danny Feng) [552648]
- [fs] proc: make errno values consistent when race occurs (Danny Feng) [556545]
- [net] igb: update driver to support End Point DCA (Stefan Assmann) [513712]
- [scsi] qla2xxx: FCP2 update, dpc bug, fast mailbox read (Rob Evers) [550286]
- [scsi] qla2xxx: fix timeout value for CT passthru cmds (Rob Evers) [552327]
- [scsi] lpfc: update to version 8.2.0.63.p2 (Rob Evers) [557792]
- [scsi] lpfc: update driver to version 8.2.0.63.1p FC/FCoE (Rob Evers) [555604]
- [scsi] be2iscsi: upstream driver refresh for rhel5.5 (Mike Christie) [554545]
- [pci] add ids for intel b43 graphics controller (John Villalovos) [523637]
- [misc] support new Nehalem processors in Oprofile (John Villalovos) [521992]
- [scsi] scsi_dh: make rdac hw handler's activate() async (Rob Evers) [537514]
- [scsi] scsi_dh: change scsidh_activate interface to async (Rob Evers) [537514]
- [alsa] support Creative X-Fi EMU20K1 and EMU20K2 chips (Jaroslav Kysela) [523786]
- [net] tg3: update to version 3.106 for 57765 asic support (John Feeney) [545135]
- [net] bonding: fix alb mode locking regression (Andy Gospodarek) [533496]
- [scsi] stex: don't try to scan a nonexistent lun (David Milburn) [531488]
- [scsi] bnx2i: additional fixes for rhel5.5 update (Mike Christie) [517378]
- [misc] hpilo: fix build warning in ilo_isr (Tony Camuso) [515010]
- [scsi] qla2xxx: add AER support (Rob Evers) [513927]
- [x86] relocate initramfs so we can increase vmalloc space (Neil Horman) [499253]
- [mm] memory mapped files not updating timestamps (Peter Staubach) [452129]- [net] emergency route cache flushing fixes (Thomas Graf) [545663] {CVE-2009-4272}
- [fs] fasync: split 'fasync_helper()' into separate add/remove functions (Danny Feng) [548657] {CVE-2009-4141}
- [scsi] qla2xxx: NPIV vport management pseudofiles are world writable (Tom Coughlan) [537318] {CVE-2009-3556}
- [net] ipv6: fix ipv6_hop_jumbo remote system crash (Amerigo Wang) [548643] {CVE-2007-4567}
- [net] e1000e: fix broken wol (Andy Gospodarek) [557974]
- [net] r8169: add missing hunk from frame length filtering fix (Jarod Wilson) [552438]- [net] e1000e: fix rx length check errors (Amerigo Wang) [551223] {CVE-2009-4538}
- [net] e1000: fix rx length check errors (Neil Horman) [552138] {CVE-2009-4536}
- [net] r8169: improved frame length filtering (Neil Horman) [550915] {CVE-2009-4537}
- kabi: fix dma_async_register symbol move (Jarod Wilson) [526342]
- [kabi] add {napi,vlan}_gro_receive and intel dca symbols (Jon Masters) [526342]
- Revert: amd64_edac: fix access to pci conf space type 1 (Jarod Wilsj0>@selinux_audit_rule_update w/audit_inode_hash (Alexander Viro) [579479]
- [virtio] fix GFP flags passed by virtio balloon driver (Amit Shah) [584683]
- [net] sctp: fix skb_over_panic w/too many unknown params (Neil Horman) [584658] {CVE-2010-1173}
- [xen] arpl on MMIO area crashes the guest (Paolo Bonzini) [572982] {CVE-2010-0730}- [acpi] warn on hot-add of memory exceeding 4G boundary (Prarit Bhargava) [571544]
- [net] tipc: fix various oopses in uninitialized code (Neil Horman) [558693] {CVE-2010-1187}
- [acpi] fix WARN on unregister in power meter driver (Matthew Garrett) [576246]
- [block] cfq-iosched: fix IOPRIO_CLASS_IDLE accounting (Jeff Moyer) [574285]
- [block] cfq-iosched: async queue allocation per priority (Jeff Moyer) [574285]
- [block] cfq-iosched: fix async queue behaviour (Jeff Moyer) [574285]
- [block] cfq-iosched: propagate down request sync flag (Jeff Moyer) [574285]
- [block] introduce the rq_is_sync macro (Jeff Moyer) [574285]
- [fs] vfs: fix LOOKUP_FOLLOW on automount symlinks (Jeff Layton) [567816] {CVE-2010-1088}
- [nfs] fix an oops when truncating a file (Jeff Layton) [567195] {CVE-2010-1087}
- [net] bnx2: fix lost MSI-X problem on 5709 NICs (John Feeney) [511368]
- [misc] make the keyring quotas controllable via /proc/sys (Amerigo Wang) [441243]
- [fs] fix kernel oops while copying from ext3 to gfs2 (Abhijith Das) [555754] {CVE-2010-1436}- [cpu] fix boot crash in 32-bit install on AMD cpus (Bhavna Sarathy) [575799]- [mm] fix boot on s390x after bootmem overlap patch (Amerigo Wang) [550974]
- [net] bnx2: avoid restarting cnic in some contexts (Andy Gospodarek) [554706]
- [misc] add missing CVE labels for entries in 2.6.18-195.el5 (Jarod Wilson)- [redhat] make sha512hmac sig failure more obvious (Jarod Wilson)
- [mm] keep get_unmapped_area_prot functional (Danny Feng) [556710] {CVE-2010-0291}
- [mm] switch do_brk to get_unmapped_area (Danny Feng) [556710] {CVE-2010-0291}
- [mm] take arch_mmap_check into get_unmapped_area (Danny Feng) [556710] {CVE-2010-0291}
- [mm] get rid of open-coding in ia64_brk (Danny Feng) [556710] {CVE-2010-0291}
- [mm] unify sys_mmap* functions (Danny Feng) [556710] {CVE-2010-0291}
- [mm] kill ancient cruft in s390 compat mmap (Danny Feng) [556710] {CVE-2010-0291}
- [mm] fix pgoff in have to relocate case of mremap (Danny Feng) [556710] {CVE-2010-0291}
- [mm] fix the arch checks in MREMAP_FIXED case (Danny Feng) [556710] {CVE-2010-0291}
- [mm] fix checks for expand-in-place mremap (Danny Feng) [556710] {CVE-2010-0291}
- [mm] add new vma_expandable helper function (Danny Feng) [556710] {CVE-2010-0291}
- [mm] move MREMAP_FIXED into its own header (Danny Feng) [556710] {CVE-2010-0291}
- [mm] move locating vma code and checks on it (Danny Feng) [556710] {CVE-2010-0291}
- [iscsi] fix slow failover times (Mike Christie) [570681]
- [misc] kernel: fix elf load DoS on x86_64 (Danny Feng) [560553] {CVE-2010-0307}
- [netlink] connector: delete buggy notification code (Jiri Olsa) [561685] {CVE-2010-0410}
- [sound] hda_intel: avoid divide by zero in azx devices (Jaroslav Kysela) [567172] {CVE-2010-1085}
- [dvb] fix endless loop when decoding ULE at dvb-core (Mauro Carvalho Chehab) [569242] {CVE-2010-1086}
- [scsi] fnic: fix tx queue handling (Mike Christie) [576709]
- [fusion] mptsas: fix event_data alignment (Tomas Henzl) [570000]
- [edac] fix internal error message in amd64_edac driver (Bhavna Sarathy) [569938]
- [fs] remove unneccessary f_ep_lock from fasync_helper (Lachlan McIlroy) [567479]
- [x86_64] fix floating point state corruption after signal (Oleg Nesterov) [560891]
- [mm] don't let reserved memory overlap bootmem_map (Amerigo Wang) [550974]
- [s390] kernel: correct TLB flush of page table entries (Hendrik Brueckner) [545527]
- [xen] iommu: clear IO-APIC pins on boot and shutdown (Paolo Bonzini) [548201]
- [xen] vtd: fix ioapic pin array (Don Dugger) [563546]
- [xen] set hypervisor present CPUID bit (Paolo Bonzini) [573771]- [net] mlx4: pass attributes down to vlan interfaces (Doug Ledford) [573098]
- [block] cfq-iosched: fix sequential read pejPh@n leak on s390 (Jan Glauber) [213568] 
- NFSv4: fs_locations support (Steve Dickson) [212352] 
- [IPv6] irrelevant rules break ipv6 routing. (Thomas Graf) [209354] 
- [IPv6] blackhole and prohibit rule types not working (Thomas Graf) [210216] 
- [KEXEC] bad offset in icache instruction crashes Montecito systems (Jarod Wilson) [212643] 
- assertion "FALSE" failed in gfs/glock.c (Dave Teigland) [211622] 
- I/O DLPAR and Hotplug not enabled in RHEL5 (Janice Girouard) [207732]- SHPCHP driver doesn't work (Keiichiro Tokunaga) [210478] 
- ext3/jbd panic (Eric Sandeen) [209647] 
- Oops in nfs_cancel_commit_list (Jeff Layton) [210679] 
- kernel Soft lockup detected on corrupted ext3 filesystem (Eric Sandeen) [212053] 
- CIFS doesn't work (Steve Dickson) [211070]- need to convert bd_mount_mutex on gfs2 also (Peter Zijlstra)- Grant table operations unsuitable for guest domains (Rik van Riel) [210489] 
- AMD-V HVM windows guest boot menu timer issue (Steven Rostedt) [209001] 
- iflags.h is not upstream (Steve Whitehouse) [211583] 
- ACPIPHP doesn't work (Keiichiro Tokunaga) [209677] 
- IBMVSCSI does not correctly reenable the CRQ (Janice Girouard) [211304] 
- librdmacm-utils failures (Doug Ledford) [210711] 
- Badness in debug_mutex_unlock at kernel/mutex-debug.c:80 (Janice Girouard) [208500] 
- Stratus memory tracking functionality needed in RHEL5 (Kimball Murray) [209173, 211604]- Can't unload gnbd module, 128 references (Peter Zijlstra) [211905]
- ddruid does not recognize dasd drives (Peter Zijlstra) [210030]- disable x86_64 dirty page tracking, it breaks some machines (Don Zickus)- possible recursive locking detected: cachefilesd (David Howells) [204615] 
- Stratus memory tracking functionality needed in RHEL5 (Kimball Murray) [209173] 
- nfs handled rpc error incorrectly (Steve Dickson) [207040] 
- cachefiles: inode count maintance (Steve Dickson) [209434] 
- mkinitrd: iSCSI root requires crc32c module (Mike Christie) [210232] 
- implemented sysrq-w to dump all cpus (Larry Woodman) 
- enable panic_on_oops (Dave Anderson) 
- re-enable x86_64 stack unwinder fixes (Don Zickus) 
- disable kernel debug flags (Don Zickus)- Fix up xen blktap merge to restore modular build- fix xen breakage from last night's incorrect commits- revert Kpobes backport from 2.6.19-rc1, it fails to compile- Update FC transport and Emulex lpfc Fibre Channel Driver (Tom Coughlan) [207551] 
- NFSv4 using memory after its freed fix (Steve Dickson) [206996] 
- GFS2 dirents are 'unkown' type (Steve Whitehouse) [210493] 
- Cachefs double unlock (Steve Dickson) [210701] 
- tty locking cleanup (Prarit Bhargava) [210249] 
- ibmveth fails in kdump boot (Janice Girouard - IBM on-site partner) [199129] 
- Kpobes backport from 2.6.19-rc1 (Anil S Keshavamurthy) [210555] 
- Ia64 - kprobe opcode must reside on 16 bytes alignment (Anil S Keshavamurthy) [210552] 
- GFS2 forgets to unmap pages (Steve Whitehouse) [207764] 
- DIO needs to avoid using page cache (Jeffrey Moyer) [207061] 
- megaraid_sas: update (Chip Coldwell) [209463] 
- NFS data corruption (Steve Dickson) [210071] 
- page align bss sections on x86_64 (Vivek Goyal) [210499] 
- blkbk/netbk modules don't load (Aron Griffis) [210070] 
- blktap does not build on ia64 (Aron Griffis) [208895] 
- blkbk/netbk modules don't load (Rik van Riel) [202971] 
- patches from xen-ia64-unstable (Rik van Riel) [210637] 
- Xen version strings need to reflect exact Red Hat build number (Stephen Tweedie) [211003] 
- updated to 2.6.18.1 stable series (Don Zickus) 
- updated execshield patch (Don Zickus) 
- revert CONFIG_PCI_CALGARY_IOMMU config (Don Zickus) 
- disable CONFIG_MAMBO (Don Zickus)- I/O errors with dm-multipath when adding new path (Alasdair Kergon) [169302] 
- Kdump on i386 fails - Second kernel panics (Vivek Goyal) [207598] 
- patch to qla4xxx for supporting ioctl module (Mike Christie) [207356] 
- lockdep fixes (Peter Zijlstra) [208165 209135 204767] 
- printk cleanup (Dave Jones) 
- spec file cleanup (Dave Jones, Bill Nottingham) 
- gfs-dlm fix (Patrick Caulfield) 
- find-providesk,@,,,rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibxslt-1.1.17-4.el5_8.3.src.rpmlibxslt-devel@@@JJ/bin/shlibexslt.so.0()(64bit)libgcrypt-devellibxml2-devellibxsltlibxslt.so.1()(64bit)pkgconfigrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)2.5.61.1.173.0.4-14.0-14.4.2.3PFyPFyPE(`HX`H1`E`DpDDaniel Veillard <veillard@redhat.com> - 1.1.17-4.el5_8.3Daniel Veillard <veillard@redhat.com> - 1.1.17-4.el5_8.2Daniel Veillard <veillard@redhat.com> - 1.1.17-4.el5_8.1Daniel Veillard <veillard@redhat.com> - 1.1.17-4.el5Daniel Veillard <veillard@redhat.com> - 1.1.17-3.el5Daniel Veillard <veillard@redhat.com> - 1.1.17-2Jesse Keating <jkeating@redhat.com> - 1.1.17-1.1Daniel Veillard <veillard@redhat.com>- CVE-2012-2825 requires an extra patch on 1.1.17- remove the ChangeLog.gz which was raising multilib problems- fixes CVE-2011-1202 CVE-2011-3970 CVE-2012-2825 CVE-2012-2871 CVE-2012-2870
- Fix portability to upcoming libxml2-2.9.0
- Fix generate-id() to not expose object addresses (CVE-2011-1202)
- Fix some case of pattern parsing errors (CVE-2011-3970)
- Fix a bug in selecting XSLT elements (CVE-2012-2825)
- Fix default template processing on namespace nodes (CVE-2012-2871)
- Fixed problem with namespace on compound predicate
- Fix direct pattern matching bug
- Big fixes of pattern compilations
- Fixes #527297 general patter comps fix and cleanup other cleanups Daniel
- QName parsing fix for patterns
- Cleanup of the pattern compilation code (CVE-2012-2870)
- Hardening of code checking node types in various entry point (CVE-2012-2870)
- Hardening of code checking node types in EXSLT (CVE-2012-2870)
- Fix system-property with unknown namespace
- Xsltproc should return an error code if xinclude fails
- Fix a dictionary string usage
- Avoid a heap use after free error- fix various problems in libexslt RC4 encryption/decryption functions
- resolves: rhbz#456233- fix a max number of steps in pattern match expressions bug
- resolves: rhbz#446892- fix multilib.patch to avoid bug #222167
- Resolves: rhbz#222167- rebuild- upstream release 1.1.17 see http://xmlsoft.org/XSLT/news.htmlbuilder10.centos.org 1347558915ٚWْْْْـ7ْْْْْْْْْْْْْْْـ9ْْْْْْٓـ8ٚ`ٚ_ٚYٚ[ٚٚٚٚٚٚٚٚٚٚٚـ ٚD/usr1.1.17-4.el5_8.3		xslt-configlibexsltexslt.hexsltconfig.hexsltexports.hlibxsltattributes.hdocuments.hextensions.hextra.hfunctions.himports.hkeys.hnamespaces.hnumbersInternals.hpattern.hpreproc.hsecurity.htemplates.htransform.hvariables.hxslt.hxsltInternals.hxsltconfig.hxsltexports.hxsltutils.hlibexslt.alibexslt.solibxslt.alibxslt.solibexslt.pclibxslt.pcxsltConf.shlibxslt.m4libxslt-devel-1.1.17AUTHORSCopyrightFEATURESNEWSREADMETODOlibexslt-api.xmllibexslt-refs.xmllibxslt-api.xmllibxslt-refs.xmllibexslt.3.gzlibxslt.3.gz/usr/bin//usr/include//usr/include/libexslt//usr/include/libxslt//usr/lib64//usr/lib64/pkgconfig//usr/share/aclocal//usr/share/doc//usr/share/doc/libxslt-devel-1.1.17//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-r5k0 @solv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)samba-common3.0.4-14.0-10:3.0.33-3.41.el5_114.4.2.3W`SA`OhODO`O`NN>N+D`M^LXL``KW|KC`K1A`K1A`K*K)X`K)X`K)X`K)X`K)X`JJ&`J	`J}`J+J+JBI`ImIlI>`I4^`H`HHɔHk`H/U`GG`GGDGG~`G,Gf`GUG`FF`Fy`Fg.`FHE`Eô`D`D	`DBDBD`DDD1`C`CC`Cw`Cw`C
JBvBU`BC8`B&7`BN`Be`B`AAAVAa`Aa`AA=A`A~Au`ApH`Am`AdjAX`AH`AF`A!.`AA
@@@q`@`@z@@q@V'`@E@1=`@1=`@-H@-H@(@`@S`??se`?AL`?`>&>k>1`>¼`>^`>>Z>UO>UO>H >/`>>Y`====mG=j=N`=A`=====9`===P`=
g`<8`<f`<<`<<<`<`<um<b<_`<<;;`;;;h;\`;;xM;q`;X;L`;Kz;5`;3;2n`;/`;/`;!J;`;	::`:`::ð`::`:::h`:`:`:x:oP`:k[:gg`9W9z`9k999`9x9p9l`9k9e`9c9[9[9Y#9W`9J`9IQ9H`9D969899f8ވ`8Y`8`8@`8K88838L18E`8+<`87t7:`7`7Q`79`77!`777O`7Z77B7j`7e{`7`5`7K`7D7A76`666k666̍`6Ș66i6"{6`5`5|^5C`5C4d`- Simo Sorce <simo@redhat.com> 3.0.33-3.41.el5- Andreas Schneider <asn@redhat.com> 3.0.33-3.40.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.39.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.38.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.37.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.36.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.35.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.34.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.33.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.32.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.30.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.29.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.28.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.26.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.25.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.24.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.23.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.21.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.20.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.19.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.18.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.17.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.16.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.15.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.14.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.13.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.12.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.11.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.10.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.10.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.9.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.8.el5Guenther Deschner <gdeschner@redhat.com> 3.0.33-3.7.el5Simo Sorce <ssorce@redhat.com> 3.0.33-3.6.el5Guenther Deschner <gdeschner@redhat.com> 3.0.32-3.5.el5Guenther Deschner <gdeschner@redhat.com> 3.0.32-3.4.el5Guenther Deschner <gdeschner@redhat.com> 3.0.32-3.3.el5Guenther Deschner <gdeschner@redhat.com> 3.0.28-3.2.el5Simo Sorce <ssorce@redhat.com> 3.0.28-1.el5_2.1Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.8Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.7Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.6Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.4Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.3Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.2Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5.1Simo Sorce <ssorce@redhat.com> 3.0.28-0.el5Simo Sorce <ssorce@redhat.com> 3.0.25b-1.el5_1.4Simo Sorce <ssorce@redhat.com> 3.0.25b-0.el5_1.2Simo Sorce <ssorce@redhat.com> 3.0.25b-0.el5.4Guenther Deschner <gdeschner@redhat.com> 3.0.25b-0.el5.3Simo Sorce <ssorce@redhat.com> 3.0.25a-0.el5.2Simo Sorce <ssorce@redhat.com> 3.0.23c-2.el5.2.0.3Simo Sorce <ssorce@redhat.co7k@ond Eivind Glomsrd <teg@redhat.com> 2.2.3a-6Trond Eivind Glomsrd <teg@redhat.com> 2.2.3a-5Trond Eivind Glomsrd <teg@redhat.com> 2.2.3a-4Nalin Dahyabhai <nalin@redhat.com> 2.2.3a-3Trond Eivind Glomsrd <teg@redhat.com> 2.2.3a-2Trond Eivind Glomsrd <teg@redhat.com> 2.2.3a-1Trond Eivind Glomsrd <teg@redhat.com> 2.2.3-1Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-8Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-7Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-6Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-5Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-4Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-3Florian La Roche <Florian.LaRoche@redhat.de> 2.2.2-2Trond Eivind Glomsrd <teg@redhat.com> 2.2.2-1Trond Eivind Glomsrd <teg@redhat.com> 2.2.1a-5Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Bill Nottingham <notting@redhat.com>Preston Brown <pbrown@redhat.com>Helge Deller <hdeller@redhat.de> Helge Deller <hdeller@redhat.de> Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Tim Waugh <twaugh@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Trond Eivind Glomsrd <teg@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Philipp Knirsch <pknirsch@redhat.com>Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Than Ngo <than@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Nils Philippsen <nils@redhat.de>Florian La Roche <Florian.LaRoche@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Dale Lovelace <dale@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com> Preston Brown <pbrown@redhat.com>Bill Nottingham <nottik@I ?d		1@D\`ip	x	
O
T`o~DF(k8t79P7:7>G@VBeFrGHIXYZ[\]^bdefkltuvwPx\yh!{   A UA
    g h Cnspr4.11.01.el5_11Netscape Portable RuntimeNSPR provides platform independence for non-GUI operating system
facilities. These facilities include threads, thread synchronization,
normal file and network I/O, interval timing and calendar time, basic
memory management (malloc and free) and shared library linking.Wbuilder17.centos.org`CentOS-5CentOSMPLv2.0System Environment/Librarieshttp://www.mozilla.org/projects/nspr/linuxi3866'؁WWW888ac911e20436d955976dd0464e9022e0c349bcffb5aafa884c60c97d97f0630cb947b2ae05e9daa36158e868402609rootrootrootrootrootrootnspr-4.11.0-1.el5_11.src.rpmlibnspr4.solibplc4.solibplds4.somozilla-nsprnspr@@@@@@@@@@@@@@@@@@@@@@JJ@/sbin/ldconfig/sbin/ldconfiglibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.2)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libdl.so.2libdl.so.2(GLIBC_2.0)libdl.so.2(GLIBC_2.1)libnspr4.solibpthread.so.0libpthread.so.0(GLIBC_2.0)libpthread.so.0(GLIBC_2.1)libpthread.so.0(GLIBC_2.2)libpthread.so.0(GLIBC_2.3.2)librt.so.1librt.so.1(GLIBC_2.2)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.4-14.0-14.4.2.3VV!s`U;`SR%`RRR`]R`]QQKPPPO`OOO`OߤOߤO%`N3`Nr`Lt@KJJ`I@;HRGGEGh`G[GGPFW\`EEuEl`El`E	DpDwz`CC`CCE`CC`C`B1B1B=`B=`BfB^Elio Maldonado <emaldona@redhat.com> - 4.11.0-0.1Elio Maldonado <emaldona@redhat.com> - 4.10.8-2Elio Maldonado <emaldona@redhat.com> - 4.10.8-1Elio Maldonado <emaldona@redhat.com> - 4.10.6-1Elio Maldonado <emaldona@redhat.com> - 4.10.2-3Elio Maldonado <emaldona@redhat.com> - 4.10.2-2Elio Maldonado <emaldona@redhat.com> - 4.10.2-1Elio Maldonado <emaldona@redhat.com> - 4.10.0-2Elio Maldonado <emaldona@redhat.com> - 4.9.5-1Elio Maldonado <emaldona@redhat.com> - 4.9.5-2Elio Maldonado <emaldona@redhat.com> - 4.9.5-1Elio Maldonado <emaldona@redhat.com> - 4.9.2-1Kai Engert <kaie@redhat.com> - 4.9.1-6Elio Maldonado <emaldona@redhat.com> - 4.9.1-5Elio Maldonado <emaldona@redhat.com> - 4.9.1-4Elio Maldonado <emaldona@redhat.com> - 4.9.1-3Elio Maldonado <emaldona@redhat.com> - 4.9.1-2Elio Maldonado <emaldona@redhat.com> - 4.9.1-1Elio Maldonado <emaldona@redhat.com> - 4.8.9-1Elio Maldonado Batiz <emaldona@redhat.com> - 4.8.9-1Elio Maldonado <emaldona@redhat.com> - 4.8.8-2Elio Maldonado <emaldona@redhat.com> - 4.8.8-1Kai Engert <kaie@redhat.com> - 4.8.6-1Elio Maldonado <emaldona@redhat.com> - 4.8.4-1Kai Engert <kengert@redhat.com> - 4.7.5-1Kai Engert <kengert@redhat.com> - 4.7.4-1Kai Engert <kengert@redhat.com> - 4.7.3-2Kai Engert <kengert@redhj,E@_policy_lookup (Eric Paris ) [218591]
- more kabi whitelist updates (Jon Masters)- scsi: fix EX8350 panic (stex.ko) (Jun'ichi Nick Nomura ) [220783]
- Audit: Mask upper bits on 32 bit syscall auditing on ppc64 (Eric Paris ) [213276]- mm: handle mapping of memory without a struct page backing it (Erik Jacobson ) [221029]
- rng: check to see if bios locked device (Erik Jacobson ) [221029]
- sata: support legacy IDE mode of SB600 SATA (Bhavana Nagendra ) [221636]
- xen: quick fix for Cannot allocate memory (Steven Rostedt ) [217056]
- XEN: Register PIT handlers to the correct domain (Herbert Xu ) [222520]
- SATA AHCI: support AHCI class code (Jeff Garzik ) [222674]
- fix vdso in core dumps (Roland McGrath ) [211744]- XEN: Replace inappropriate domain_crash_synchronous use (Herbert Xu ) [221239]
- SATA timeout boot message  (Peter Martuccelli ) [222108]
- Netlabel: off by one and init bug in netlbl_cipsov4_add_common (Eric Paris ) [221648]
- NetLabel: fix locking issues (Eric Paris ) [221504]
- mm: fix statistics in vmscan.c (Peter Zijlstra ) [222030]
- usb: Sun/AMI virtual floppy issue (Pete Zaitcev ) [219628]
- bonding: eliminate rtnl assertion spew (Andy Gospodarek ) [210577]
- Xen: Make HVM hypercall table NR_hypercalls entries big. (Herbert Xu ) [221818]
- xen: Add PACKET_AUXDATA cmsg (Herbert Xu ) [219681]- ppc64: initialization of hotplug memory fixes (Janice M. Girouard ) [220065]
- GFS2: return error for NULL inode (Russell Cattelan ) [217008]
- scsi: prevent sym53c1510 from claiming the wrong pci id (Chip Coldwell ) [218623]
- net: Disable the qla3xxx network driver. (Tom Coughlan ) [221328]
- xen: Disable CONFIG_IDE_GENERIC (Jarod Wilson ) [220099]
- sound: add support for STAC9205 codec (John Feeney ) [219494]
- ipv6: panic when bringing up multiple interfaces (Thomas Graf ) [218039]
- XFRM Audit: correct xfrm auditing panic (Eric Paris ) [222033]
- edac: fix /proc/bus/pci/devices to allow X to start (John Feeney ) [219288]
- x86_64: clear_kernel_mapping: mapping has been split. will leak memory. (Larry Woodman ) [218543]
- xen: >4G guest fix (Steven Rostedt ) [217770]
-  fs: listxattr syscall can corrupt user space programs (Eric Sandeen ) [220119]
- CacheFiles: Fix object struct recycling (David Howells ) [215599]
- Remove capability requirement to reading cap-bound (Eric Paris ) [219230]
- disable building ppc64iseries (Don Zickus) [219185]
- update: utrace fixes (Roland McGrath) [214405 215052 216150 209118]
- PPC config file changes for IPMI and DTLK (Peter Martuccelli ) [210214]
- update: Xen: emulate PIT channels for vbios support (Stephen C. Tweedie ) [215647]
- net: qla3xxx panics when eth1 is sending pings (Konrad Rzeszutek ) [220246]
- s390: inflate spinlock kabi (Jan Glauber ) [219871]
- x86: Add panic on unrecovered NMI (Prarit Bhargava ) [220829]
- ppc64: fix booting kdump env. w/maxcpus=1 on power5 (Jarod Wilson ) [207300]
- netfilter: iptables stop fails because ip_conntrack cannot unload. (Thomas Graf ) [212839]
- gfs: Fix gfs2_rename lock ordering (for local filesystem) (Wendy Cheng ) [221237]
- GFS2: Fix ordering of page disposal vs. glock_dq (Steven Whitehouse ) [220117]
- xen: fix nosegneg detection (Rik van Riel ) [220675]
- mm: Fix for shmem_truncate_range() BUG_ON() (Larry Woodman ) [219821]
- x86_64: enabling lockdep hangs the system (Don Zickus ) [221198]
- dlm: change some log_error to log_debug (David Teigland ) [221326]
- dlm: disable debugging output (David Teigland ) [221326]
- fs: ext2_check_page denial of service (Eric Sandeen ) [217018]
- CPEI - prevent relocating hotplug irqs (Kei Tokunaga ) [218520]
- Networking: make inet->is_icsk assignment binary (Eric Paris ) [220482]
- net: b44: phy reset problem that leads to link flap  (Neil Horman ) [216338]
- autofs - fix panic on mount fail - missing autofs module update (Ian Kent ) [221118]
- net: act_gact: division by zero (Thomas Graf ) [218348]
- ppc64: Avoid panic when taking altivec exceptions from userspace. (David Woodhouse ) [220586]- new set of kabi whitelists (Jon Masters) [218682]
- x86: remokC?,@?,>,@,0.50- upgrade to 0.36.2 which fixes an exploit where
  users can attach to another user's session bus (CAN-2005-0201)- Upgrade to dbus-0.36.1
- Install all files to lib64/ on 64bit machines- Upgrade to dbus-0.36
- Split modules that go into lib/python2.4/site-packages/dbus
and those that go into %{python_sitelib}/dbus (they differ on 64bit)
- Renable Qt bindings since packages in core can use them- Upgrade to dbus-0.35.2
- removed dbus-0.34-kill-babysitter.patch
- removed dbus-0.34-python-threadsync.patch
- removed dbus-0.23-selinux-avc-audit.patch
- added dbus-0.35.2-selinux-avc-audit.patch
- take out restarts on upgrade- Upgrade to dbus-0.34
- added dbus-0.34-kill-babysitter.patch
- added dbus-0.34-python-threadsync.patch
- remove dbus-0.32-print_child_pid.patch
- remove dbus-0.32-deadlock-fix.patch
- remove dbus-0.33-types.patch- Add new libaudit patch from Steve Grub and enable in configure
  (Bug #159218)- remove static libraries from python bindings- Backport patch from CVS that fixes int32's being marshaled as
uint16's in the python bindings- update to upstream 0.33
- renable selinux audit patch- Added patch to fix deadlocks when using recursive g_mains- replace selinux_init patch with selinux_chroot_workaround patch
  to work around bad selinux interactions when using chroots
  on the beehive build machines- add print_child_pid patch which make sure we prin the child's pid if we fork- add fix for glib infinite loop (fdo #2889)- add selinux-init patch to fix dbus from segfaulting when
  building on machines that don't have selinux enabled- update to upstream version 0.32- Pyrex has been patched to generate gcc4.0 complient code
- Rebuild for gcc4.0- change compat-gcc requirement to compat-gcc-32
- rebuild with gcc 3.2- Remove precompiled init script and let the sources generate it- update to upstream version 0.31
- take out user has same id patch (merged upstream)
- udi patch updated
- dbus-daemon-1 renamed to dbus-daemon
- dbus-glib-tool renamed to dbus-binding-tool
- force gcc33 because pyrex generate improper lvalue code
- disable audit patch for now- Explicitly pass in the pid file location to ./configure instead of
  letting it guess based on the build enviornment- Add patch to fix random users from connecting to a users session bus- Add Steve Grubb's SE-Linux audit patch (Bug# 144920)- Update to upstream version 0.23
- Drop all patches except for the UDI patch as they have been 
  integrated upstream 
- List of API changes:
      * add setgroups() to drop supplementary groups
      * removed dbus_bug_get_with_g_main since it's been replaced by dbus_g_bus_get
      * added support for int64 and uint64 to the python bindings
      * use SerivceOwnerChanges signal instead of ServiceCreated and ServiceDeleted- rebuild against python 2.4- Add a requires for glib2-devel in the devel package
- Add SE-Linux backport from Colin Walters that fixes 
  messages getting lost in SE-Linux contexts- Bump up release and rebuild- Run /sbin/ldconfig for glib sub-package (bug #134062).- Fixed patch to use dbus-1 instead of dbus-1.0
- (configure.in): Exported just the datadir instead of
  the full path to the dbus datadir for consistency- Adding patch to move /usr/lib/dbus-1.0/services to
  /usr/share/dbus-1.0/services- reverting BuildRequires: redhat-release because of issues with build system
- added precompiled version of the messagebus init script- changed /etc/redhat-release to the package redhat-release- added python int64 patch from davidz- added BuildRequires: /etc/redhat-release (RH Bug #132436)- Added Steve Grubb's spec file patch (RH Bug #130201)- Disabled dbus-gtk since dbus-viewer doesn't do anything right now- Moved dbus-viewer to new dbus-gtk package so that dbus-glib
  no longer requires X or GTK libraries. (RH Bug #130029)- Update to new 0.22 release- Added BuildRequires for libselinux-devel and Requires for libselinux- Add SE-DBus patch- Added lib64 workaround for python bindings installing to
  the wrong lib directory on 64 bit archs- Updated c"l0H0@00 0ngyelp-watermark-blockquote-201E.pngimportant_docs.xmlinfo.xmlman.xmlscrollkeeper.xmltoc.xmluiyelp-search-ui.xmlyelp-ui.xmlyelp.gladexsltdb-title.xsldb2html.xslinfo2html.xslman2html.xslsearch2html.xsltoc2html.xslyelp-common.xslyelp.js/etc/gconf/schemas//usr/bin//usr/share/applications//usr/share/icons//usr/share/icons/hicolor//usr/share/icons/hicolor/192x192//usr/share/icons/hicolor/192x192/apps//usr/share/locale/af/LC_MESSAGES//usr/share/locale/am/LC_MESSAGES//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/az/LC_MESSAGES//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/br/LC_MESSAGES//usr/share/locale/bs/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cy/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/dz/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_CA/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ku/LC_MESSAGES//usr/share/locale/ky/LC_MESSAGES//usr/share/locale/li/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/lv/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mn/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nds@NFE/LC_MESSAGES//usr/share/locale/ne/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/nso/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/rw/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@Latn/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/tg/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/ug/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/wa/LC_MESSAGES//usr/share/locale/xh/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_HK/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/locale/zu/LC_MESSAGES//usr/share//usr/share/yelp//usr/share/yelp/icons//usr/share/yelp/ui//usr/share/yelp/xslt/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnu	<k-6@65-j if avaliable
- merge the winbindd_privileged change from 3E
- merge the "rm /usr/lib" patch that allows Samba to build on 64-bit
  platforms despite the broken Makefile- Merge from samba-3E-branch after samba-3.0.0rc1 was released- Merge from 3.0.0-2beta3.3E
- (Correct log file names (#100981).)
- (Fix pidfile directory in samab.log)
- (Remove obsolete samba-3.0.0beta2.tar.bz2.md5 file)
- (Move libsmbclient to the -common package (#99449))- rebuild- rebuilt- add libsmbclient.so for gnome-vfs-extras
- Edit specfile to specify /var/run for pid files
- Move /tmp/.winbindd/socket to /var/run/winbindd/socket- add proper ldconfig calls- upgrade to 2.2.8a
- remove old .md5 files
- add "pid directory = /var/run" to the smb.conf file.  Fixes #88495
- Patch from jra@dp.samba.org to fix a delete-on-close regression- Upgrade to 2.2.8
- removed commented out patches.
- removed old patches and .md5 files from the repository.
- remove duplicate /sbin/chkconfig --del winbind which causes
  warnings when removing samba.
- Fixed minor bug in smbprint that causes it to fail when called with
  more than 10 parameters: the accounting file (and spool directory
  derived from it) were being set wrong due to missing {}.  This closes
  bug #86473.
- updated smb.conf patch, includes new defaults to close bug #84822.- rebuilt- remove swat.desktop file- relink libnss_wins.so with SHLD="gcc -lnsl" to force libnss_wins.so to
  link with libnsl, avoiding unresolved symbol errors on functions in libnsl- edited spec file to put .so files in the correct directories
  on 64-bit platforms that have 32-bit compatability issues
  (sparc64, x86_64, etc).  This fixes bugzilla #83782.
- Added samba-2.2.7a-error.patch from twaugh.  This fixes
  bugzilla #82454.- rebuilt- Update to 2.2.7a
- Change default printing system to CUPS
- Turn on pam_smbpass
- Turn on msdfs- use internal dep generator.- don't use rpms internal dep generator- Fix missing doc files.
- Fix multilib issues- update to 2.2.7
- add patch for LFS in smbclient (<tcallawa@redhat.com>)- logrotate fixes (#65007)- /usr/lib was used in place of %{_libdir} in three locations (#72554)- Initscript fix (#70720)- Enable VFS support and compile the "recycling" module (#69796)
- more selective includes of the examples dir- Fix the lpq parser for better handling of LPRng systems (#69352)- desktop file fixes (#69505)- Enable ACLs- Make it not depend on Net::LDAP - those are doc files and examples- automated rebuild- 2.2.5- Move the post/preun of winbind into the -common subpackage, 
  where the script is (#66128)- Fix pidfile locations so it runs properly again (2.2.4 
  added a new directtive - #65007)- automated rebuild- Fix #64804- 2.2.4
- Removed some zero-length and CVS internal files
- Make it build- Don't use /etc/samba.d in smbadduser, it should be /etc/samba- Add libsmbclient.a w/headerfile for KDE (#62202)- Make the logrotate script look the correct place for the pid files- include interfaces.o in pam_smbpass.so, which needs symbols from interfaces.o
  (patch posted to samba-list by Ilia Chipitsine)- Rebuild- 2.2.3a- 2.2.3- New pam configuration file for samba- Enable PAM session controll and password sync- Move winbind files to samba-common. Add separate initscript for
  winbind 
- Fixes for winbind - protect global variables with mutex, use
  more secure getenv- Teach smbadduser about "getent passwd" 
- Fix more pid-file references
- Add (conditional) winbindd startup to the initscript, configured in
  /etc/sysconfig/samba- Fix pid-file reference in logrotate script
- include pam and nss modules for winbind- Add "--with-utmp" to configure options (#55372)
- Include winbind, pam_smbpass.so, rpcclient and smbcacls
- start using /var/cache/samba, we need to keep state and there is
  more than just locks involved- add "reload" to the usage string in the startup script- 2.2.2- Add patch from Jeremy Allison to fix IA64 alignment problems (#51497)- Don't include smbpasswd in samba, it's in samba-common (#51598)
- Add a disabledk+@++D?d
		Hdh	cLc	c
cdcc
<ccccPP(89 (:6>uA@uPGu`cHvcIxxcXyTYyp\yc]{c^oCbdEeJfOkQlXtpcucvwcx$cy{cAA
ZcghClibuser0.54.73.el5A user and group account administration library.The libuser library implements a standardized interface for manipulating
and administering user and group accounts.  The library uses pluggable
back-ends to interface to its data sources.

Sample applications modeled after those included with the shadow password
suite are included.P!builder20.centos.org$CentOS-5CentOSLGPLSystem Environment/Baselinuxx86_64	]`N0k ݐ]ML_+@]S ]PO]#b>b&Q\u8wTRmIJHNZ3DmLFR PpnLOQyJJ_MSyTTyy](} IxyIJ:7jMLK^qyKJy^*K8Jrt8^;y:F:FkLU
AA큤P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!:RG<GE=;{<;DU:RD'P!yP!yP!zP!zP!zP!zP!zP!zP!{P!{P!{P!{P!{P!{P!|P!|P!|P!|P!|P!|P!}P!}P!}P!}P!}P!~P!~P!~P!~P!~P!~P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!P!a6bbb96cf48d28985c235d7aef9c25b761f14a6de3ada5c4ccc341d057a7d9ca31fb2d5eb41665a0bee18bbe180a2adaf925a5ee5e3ca086a681aaf9f8a3bc6426e6d5d73af9872730d94156345e1e5c829e58f87550be8a6a7a19f879f51e4d19e499380e5486be4d93524e795c0ad6a1d9325613cc7cead1bb134bc9dfe562e052a75fddfe73e64985a8b7e22312a8fde38548e646843cc252e7ebcbd868c4e3e1c471fae8e0d98855f2c9f7a3870191187dd8f58c0163c2f8bca5723620eb091e4b21c926ce3405e6044edd8215523ed6fb122afd7de870275e68057734044ba2bef1c52cf650d422f25870ef477c3c96de7e17466cb2f27a5b6d85b2b0345211efaeb0f6a5ce101587bd905eb5919c300bcd5f6d3a1ec034ae308a340fdfd267b0d7ea4f5c8a59ddeaf28ba379a03bf50002aefd002f49e7bb854063f7e7db1df3e8445c9978b042009d4522311c3e5503185870726bce4d60168076114a245e26c0676951170e04d002e02f0d53be02ef7fb8abd04967c8ccc5ca004812b2a6b7b22f643a2c9e8b3f3e3ba47eaa8794ca54a08d0ca9a66b18f5f2abd59b5b2bf3fb3883821a1c880ac37e967a01fefcf569dcb3bedac7f10fb6954b6563d2d195c1de8b44e2e056e046a1a08b511aa7c22142f651a2618c42d911849fbdcbb36426e5784ad0fdd0aef3718619f621666067f36f7399b9b6597333e8be10a54e11816b4d98e3723af888b17692d571a1ad9053809bed4e4e70649be050584737b4166b6abb23a9260c7b7ab8513485d97d6702b59d3375dccbf26c20bb023ed08dca5300b8a1b7f2b89b8f15f049b06772d5a5f5643c151aabbea35f9cc058c2697f05fea9afff13f5b4b4b953736fb05ab3192fb39c0253b47fd99b10a1e03f2a397442bc4l`D.@..smod/bin/shmodulesmodutils-develmodutilsbuilder17.centos.org 1380654734DDDDDDC
;C	C	yC	}C	C	|C	{C	~C
@C
?C
>C	C
AC	C
:C
=C	C
C
9C
<3.3-0.pre3.1.63.el53.33.3-0.pre3.1.63.el5depmod.ddepmod.conf.distmodprobe.confmodprobe.dblacklist-compatmodprobe.conf.distdepmodgenerate-modprobe.confinsmodinsmod.staticlsmodmodinfomodprobermmodweak-modulesdepmod.conf.5.gzdepmod.d.5.gzmodprobe.conf.5.gzmodprobe.d.5.gzmodules.dep.5.gzdepmod.8.gzinsmod.8.gzlsmod.8.gzmodinfo.8.gzmodprobe.8.gzrmmod.8.gz/etc//etc/depmod.d//etc/modprobe.d//sbin//usr/share/man/man5//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII English textASCII textBourne shell script text executableBourne-Again shell script text executableELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, statically linked, strippeddirectoryempty
RRRR	R
RRRRRRRRR	RRRR	R
RRRR	R
RRRR	R
RR? z!)M?RKjzGV(df(4ـvQmuA`)SF-D?RKjzGV((p$@~%H*ޅ[2CkA7(659fdfaa6f1e1159dacd2ca96af1f4fae8f2daf6\=>
\<	

 !"#$%&')*,./0245679;<>?@ABCDEFHJKLMOPQRSTUVXYZ[\]^_`abcefgiklnoprsuvwxyz|}~kPj<,@<,=,IG?F.d		7`d|		
&
<DNXt|B(s8|9:>C@CBDFD
GD0HD8ID@XDDYDLZD\[D`\Dh]Dp^DbDdE9eE>fECkEElEJtE`uEhvEpwExEyE
{F,F@FDFTAFA
FGGGgGhGCdbus-libs1.1.221.el5Libraries for accessing D-BUSLowlevel libraries for accessing D-BUSRKEbuilder17.centos.orgCentOS-5CentOSGPLv2+ or AFLDevelopment/Librarieshttp://www.freedesktop.org/software/dbus/linuxi386RKERKEeb30cd8d41574f7c41b9fc1c71df68d2libdbus-1.so.3.4.0rootrootrootrootdbus-1.1.2-21.el5.src.rpmlibdbus-1.so.3dbus-libs@@@@@@@@@@@@@JJJ@/sbin/ldconfig/sbin/ldconfigdbuslibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.2)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.2.4)libc.so.6(GLIBC_2.3.2)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libcap.so.1libdbus-1.so.3rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rpmlib(VersionedDependencies)rtld(GNU_HASH)1.1.2-21.el53.0.4-14.0-13.0.3-14.4.2.3RQ(Nξ`NŃN1M|MK+`K&`HHHڸ`HH`H%`G:`EEwEnEZ<`EXE :`Eh`E	DDD8`DŸDD`D`DYDYDYD`DpDDDkDhDNDDCCCCC`CQC]`C]`CCCC`Cr`C `C`CC`B&`B`B`BR`BuQ`Bmh`B\DB\DBZ`BU`BLrBLrBAB8`B. `B,AA`A{`A{`A`A`Am`Ak`AQAQAJAJAJAJA#`A!.`A!.`A`AA`A
A
A8@ܠ`@ܠ`@ܠ`@q`@@`@d@@`@K@E@=@-H@-H@*?`?????x`?wY?.`>k>ư>_`>_`>
>
>:>>>`>`>`Richard Hughes <rhughes@redhat.com> - 1.1.2-21.el5Richard Hughes <rhughes@redhat.com> - 1.1.2-20.el5Richard Hughes <rhughes@redhat.com> - 1.1.2-19.el5Richard Hughes <rhughes@redhat.com> - 1.1.2-18.el5Colin Walters <walters@redhat.com> - 1.1.2-17Richard Hughes <rhughes@redhat.com> - 1.1.2-16.el5Richard Hughes <rhughes@redhat.com> - 1.1.2-15.el5David Zeuthen <davidz@redhat.com> - 1.1.2-14.el5Dan Williams <dcbw@redhat.com> - 1.1.2-13Dan Williams <dcbw@redhat.com> - 1.1.2-12Dan Williams <dcbw@redhat.com> - 1.1.2-11Dan Williams <dcbw@redhat.com> - 1.1.2-10Dan Williams <dcbw@redhat.com> - 1.1.2-9David Zeuthen <davidz@redhat.com> - 1.0.0-8.el5David Zeuthen <davidz@redhat.com> - 1.0.0-7.el5David Zeuthen <davidz@redhat.com> - 1.0.0-6.2.el5David Zeuthen <davidz@redhat.com> - 1.0.0-6.el5Ray Strode <rstrode@redhat.com> - 1.0.0-4John (J5) Palmieri <johnp@redhat.com> - 1.0.0-3John (J5) Palmieri <johnp@redhat.com> - 1.0.0-2John (J5) Palmieri <johnp@redhat.com> - 1.0.0-1Jesse Keating <jkeating@redhat.com> - 0.93-3Matthias Clasen <mclasen@redhat.com> - 0.93-2John (J5) Palmieri <johnp@redhat.com> - 0.93-1Dan Walsh <dwalsh@redhat.com> - 0.92-2John (J5) Palmieri <johnp@redhat.com> - 0.92-1John (J5) Palmieri <johnp@redhat.com> - 0.90-8John (J5) Palmieri <johnp@redhat.com> - 0.90-7John (J5) Palmieri <johnp@redhat.com> - 0.90-6John (J5) Palmieri <johnp@redhat.com> - 0.90-5John (J5) Palmieri <johnp@redhat.com> - 0.90-4John (J5) Palmieri <johnptiPv@dogtail@@@@JJ/bin/sh/bin/sh/usr/bin/pythongnome-python2-gconfpygtk2pygtk2-libgladepyspipython(abi)rpm-pythonrpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)xorg-x11-server-Xvfbxorg-x11-xinit0.6.02.43.0.4-14.0-14.4.2.3MLvJaEl`E4E`DDDD w`CCG`C`C]Y`CHA`Jaroslav Reznik <jreznik@redhat.com> - 0.6.1-4Zack Cerza <zcerza@redhat.com> - 0.6.1-3Zack Cerza <zcerza@redhat.com> - 0.6.1-2Zack Cerza <zcerza@redhat.com> - 0.6.1-1Zack Cerza <zcerza@redhat.com> - 0.6.0-1Zack Cerza <zcerza@redhat.com> - 0.5.2-1Zack Cerza <zcerza@redhat.com> - 0.5.1-3Zack Cerza <zcerza@redhat.com> - 0.5.1-2Zack Cerza <zcerza@redhat.com> - 0.5.1-1Zack Cerza <zcerza@redhat.com> - 0.5.0-2Zack Cerza <zcerza@redhat.com> - 0.5.0-1Zack Cerza <zcerza@redhat.com> - 0.4.3-1Jeremy Katz <katzj@redhat.com> - 0.4.2-1- Add pygtk2-libglade dependency. Resolves: #435714.- Add sniff-about-close.patch. Resolves: #250219.
- Add no-usr-bin-env.patch. Resolves: #521339.- Add fix-logdir-perms.patch. Resolves: #214945.
- Add limit-children.patch. Resolves: #211082.- New upstream release.- New upstream release.
- Add Requires for xorg-x11-xinit.
- Add Requires for gnome-python2-gconf.
- Bump pyspi Requires.- New upstream release.
- Update Requires from Xvfb to xorg-x11-server-Xvfb.
- Bump pyspi Requires.
- Remove ImageMagick Requires.
- Escape post-macro in changelog-macro.- Fix the URL field.- Fix URL and Source0 fields.
- Fix desktop-file-utils magic; use desktop-file-install.- Remove BuildRequires on at-spi-devel. Added one on python.
- Use macros instead of absolute paths.
- Touch _datadir/icons/hicolor/ before running gtk-update-icon-cache.
- Require and use desktop-file-utils.
- postun = post.
- Shorten BuildArchitectures to BuildArch. The former worked, but even vim's 
  hilighting hated it.
- Put each *Requires on a separate line.
- Remove __os_install_post definition.
- Use Fedora Extras BuildRoot.
- Instead of _libdir, which kills the build if it's /usr/lib64, use a
  python macro to define python_sitelib and use that.
- Remove the executable bit on the examples in install scriptlet.
- Remove call to /bin/rm in post scriptlet.
- Use dist in Release.- It looks like xorg-x11-Xvfb changed names. Require 'Xvfb' instead.
- Remove Requires on python-elementtree, since RHEL4 didn't have it. The 
  functionality it provides is probably never used anyway, and will most likely
  be removed in the future.
- Don't run gtk-update-icon-cache if it doesn't exist.- New upstream release.
- Added missing BuildRequires on at-spi-devel.
- Added Requires on pyspi >= 0.5.3.
- Added Requires on rpm-python, pygtk2, ImageMagick, xorg-x11-Xvfb, 
  python-elementtree.
- Moved documentation (including examples) to the correct place.
- Make sure /usr/share/doc/dogtail is removed.
- Added 'gtk-update-icon-cache' to %post.- New upstream release.- Initial build./bin/sh/bin/shbuilder10.centos.org 1301520978(_(`(](^(+(-(=(M(0(@(P(/(?(O(4(D(T(3(C(S(,(<(L(5(E(U(;(K([(.(>(N(:(J(Z(8(H(X(9(I(Y(6(F(V(7(G(W(1(A(Q(2(B(R((R(f(g(h(i(m(o(p(q(s(n(r(v(l(j(k(u(t(r(s(u(t(v((~(((x({(w(}((Rk`,@ns" behaviour backward-compatible with 2.6.8
  Resolves: #339971 (comment #5)
- Truncate a copied sparse file at the end of transaction (-S, --sparse option)
  Resolves: #530866
- Add -fno-strict-aliasing to CFLAGS
- Remove obsolete rsync-2.6.8-xattr_bug.patch
- Switch license to GPLv3+ (upstream change beginning with 3.0.0)- rebuild- Add my xattrs_bug patch to fix a bug where xattrs don't get sent correctly.
- Add BuildRequires to make sure libattr-devel and libacl-devel are avaliable
- replace --with... with --enable... so they actually work
- Add make, autoconf and gcc to BuildRequires- New upstream release
- Use the upstream xattr patch instead of mine.  This closes
  bz#190208 CVE-2006-2083 rsync buffer overflow issue- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- New upstream release.  See the NEWS file for details.- New upstream release- new upstream pre-release- Include the -address patch from upstream, to close
  bz#154752 Unable to use --address in client mode- New upstream version- bump release, rebuild with gcc4
- pass RPM_OPT_FLAGS to make- Added my -xattr patch, which is based on the -acl patch.- New upstream release.- new upstream version.- New upstream version with security fix for CAN-2004-0792
- This obsoletes the -lastdir-corruption patch.- rebuilt- Backport fix for crasher when passing multiple directories of the same
  length (bug #123708)- New upstream version to correct the problems with 2.6.1.
  This obsoletes all the patches to 2.6.1- Rsync 2.6.1 final.
- Add a patch from Wayne Davison <wayned@samba.org> that fixes a
  use of uninitilized memory in the map_uid and map_gid functions.
- Add another patch from Wayne Davidson that fixes the -R option.
- Add a patch (extracted from a patch by Sami Farin
  <safari-rsync@safari.iki.fi>) to not ignore the return value
  of close().- New upstream version- rebuilt- New upstream version, obsoletes the rsync-2.5.6-signal.patch- rebuild- update to 2.5.7- rebuild in new build env- spec file fix- rebuild in new build env- fixed spec - added patch0 to prep.- rebuild in new build env- add rsync-2.5.6-signal.patch to fix kernel warnings that
  appear because socket.c sets SIGCHLD to SIG_IGN and then
  calls wait.  This is in response to bug#98740.  This patch
  *has* been committed to CVS upstream and will be in
  upstream rsync-2.5.7.- build scratch - for compile warnings- build scratch - for compile warnings- rebuild in new build env- removed rsync-2.5.6-sign.patch.  Upstream code
  incorporates signed vs unsigned changes.- build scratch - added rsync-2.5.6-sign.patch.- build scratch.- build scratch - deleted rsync-2.5.6-sign.patch.- rebuild in new build env- removed patch rsync-2.5.4-maxdel.patch
- removed patch rsync-2.4.6-segv.patch
   - current 2.5.6 properly handles (no segfault) the situation
     (rsync '[a]') that caused a need for this patch.
- added patch rsync-2.5.6-sign.patch, which is a working
  subset of patches (that still apply) included in the original
  rsync-2.5.4-moresignage.patch- rebuilt- rebuild in new build env- fixed changelog comments- rebuild in new build env- update to 2.5.6 from upstream- rebuilt- fix spelling mistake in rsync.xinetd.  #66036 & dup #75006- rebuild on all arches- update to 2.5.5- automated rebuild- automated rebuild- upstream patches: fix accidental use of --whole-file, fix
  minor memory leak, and bad worst-case child kill behavior
- make passing -e to rsync:// URLs not cause an error exit (#62489)- update to 2.5.4, do assorted patchmerging- fix --address (#60127)
- call setgroups before dropping privs (<mkp@samba.org>)- fix some errors in the unsigned patch- rebuild to get proper LFS_CFLAGS- fix some signed/unsigned issues (<krahmer@suse.de>)
- tweak ipv6 patch (#55337, <john.l.villalovos@intel.com>)
- make xinetd file %config(noreplace)- fix segfault on weird arguments (#51801)- IPv6 patch (<pekkas@netcore.fi>) (#47780)- add patch to fix hangs at end of sync, and other odd l3.@... sound tweaks- rebuilt- remove back compat, rename to module-init-tools- fix sound restoring on module load when done via OSS compat- don't buildreq autoconf-2.13 (#116770)
- sound-slot-0/snd-card-0 hacking-around- modinfo: use new modinfo if passed <foo>.ko- Added the mounting of /proc/fs/nfsd to modprobe.conf.dist
  so it gets mounted when nfsd is loaded.- /var/lib/nfs/rpc_pipefs not /var/lib/rpc_pipes should be
  mounted when sunrpc is loaded.- umount rpc_pipefs when sunrpc is unloaded- add nfsv4 aliases to modprobe.conf.dist
- clean out upstreamed aliases in modprobe.conf.dist
- mount rpc_pipefs when sunrpc is loaded- blacklist eth1394 (#117383)- update module-init-tools to 3.0pre10
- fix modinfo (#116305)
- always include /etc/modprobe.conf.dist (don't require the line in modprobe.conf)
- ship a static modprobe.conf.dist, don't generate it at build time
- clean up modprobe.conf.dist a little (#113772, #113768)- rebuilt- don't use trampolines in insmod, working around #106005- fix irda (#114268), bluetooth (#114019) and alsa aliases- add OSS compat ALSA module aliases for 2.6- update to 2.4.26
- switch around man pages; the module-init-tools man pages are now
  the default
- add backwards compat usb aliases for the simple case
- add some commentary to modules.conf/modprobe.conf on conversion
- modutils-devel goes away- fix handling of updates path (#106482)- add modprobe.conf(5) (#105760, <salimma1@yahoo.co.uk>)- update to module-init-tools-0.9.14, enable zlib, adjust patches- provide module-init-tools- fix bluetooth typo (#88859)
- add viocd alias (#89232)- fix leak in module-init-tools-depmod (<arjanv@redhat.com>)
- look in /lib/modules/`uname -r`/updates for modules- fix modprobe -C when there is no modules.dep file- add IPSEC encryption & auth aliases
- fix alias- rebuilt- add joystick alias (#91309)
- add alias for af_key for IPSEC
- update module-init-tools to 0.9.12
- ship a modprobe.conf.dist with the aliases that are built into 2.4
  modutils
- generate a modprobe.conf if needed on install- update to 2.4.25
- add floppy alias back (#89097)
- add bluetooth aliases (#88859)- quick hack fix for depmod so the installer will work- include support for 2.5/2.6 kernels- alias block-major-2 off, we never ship it as a module (#71036)- make sure we don't use diet anywhere but x86, even if it's lying around
- fix zlib linkage, for real
- switch ftape alias (#7674)- add patch for genksyms to not segfault in drivers/char/joystick
  for mainframe kernel builds- rebuilt- fix zlib static linkage patch- add alias for tun/tap (#80491)- add an IBM patch to also load 64bit kernel modules via a 31bit compiled app- update to 2.4.22
- don't link zlib dynamically- update to 2.4.21
- enable zlib for insmod.static, normal- add check for gcc version mismatch between kernel/modules
  (<arjanv@redhat.com>)- update to 2.4.18
- add some more default aliases
- fix checking of kernel version- update to 2.4.16- automated rebuild- automated rebuild- force kallsyms on modules- fix support for symbols that contain _R (<streeter@redhat.com>)- update to 2.4.14
- take out genksyms.old, no more buildprereq for gperf- rebuild against diet
- reenable rmmod in the library version, shrink it too- rebuild in earlier environments- various space shavings in -devel- bump rev
- buildprereq gperf- update to 2.4.13
- fix GPL symbol export- shrink insmod.static- fix installation of extra libraries (#58427)- hack to allow depmod of 64bit kernels on 32bit PPC- more ppc64 fixes- fix build on combined 32/64 targets (ppc/sparc)- added a -devel subpackage that contains libraries that apps can use
  to implement insmod and rmmod- get rid of some obsolete patches, other tweaks- update to 2.4.12- update to 2.4.11- update to 2.4.10
- deprecate -i, -m arguments to depmod- update to 2.4.9- replace modutils-2.4.6-error patch with version that was integrated
  upstream- disable char-major-4 for s390/s390x- remove /etc/cron.d/kmod- update to 2.4.6
- alias binfmt-0000 off (#9709)
- turnHk@armless warning
  messages to X_DEFAULT or X_INFO. (#227386)- xserver-1.3.0-pci-bus-count.patch: Allocate pci_devp dynamically, to handle
  machines with more than 128 PCI devices. (#219390 and others)* xserver-1.2.0-glcore-visual-count.patch: Fix a crash at exit when using
  software GLX. (#230367)- cve-2007-1003.patch. xc misc overflows (#233001) (sync from zstream)- xorg-xserver-1.1.0-dbe-render.diff: CVE #2006-6101. (#221204)- xorg-x11-server-1.1.1-vt-activate-is-a-terrible-api.patch: During server
  shutdown, be sure to wait for the VT switch to finish before actually
  terminating.  Works around a race seen in rhgb. (#219184)- define-xfree86-server.patch: Define XFree86Server even on arches where
  we don't compile the Xorg DDX (ie. s390). Resolves: 219253- xorg-x11-server-1.1.1-glcore-visual-matching.patch: When matching GLX to
  X visuals, scan both lists. (#218395)- Bimp release.- show-default-module-path.patch
- show-default-library-path.patch
  Patches to fix #213069.- xorg-x11-server-1.1.1-xkb-vidmode-switch.patch: Fix string matching on XKB
  actions to be case-insensitive again. (#218336)
- xorg-x11-server-1.1.1-vt-activate-is-a-terrible-api.patch: Change behaviour
  to simply exit if we lose the VT switch race. (#218396)
- Fix OS name from FC5 to RHEL5.- Disable composite when xinerama is enabled. 
- Resolves: #213102
- Make sure no-pseudocolor-composite.patch is applied
- Related: #215576- xorg-x11-server-1.1.1-maxpixclock-option.patch: Allow the maximum pixel
  clock of a monitor to be specified in the config file. (#214869)- xorg-x11-server-1.1.1-no-pseudocolor-composite.patch: Don't attempt to
  initialize Composite when the default visual is < 16bpp. (#215576)- randr-disabled-fb.patch
  Add patch to prevent RandR from disabling (and then enabling) access to
  the framebuffer. Bug 214739.- Build both x86emu and vm86 backends on x86.  Prefer x86emu when running
  in Xen dom0.  Add "Int10Backend" option to the ServerLayout section to
  allow runtime configuration.  (#213151)- Deliver SecurityPolicy in the Xvfb subpackage on arches without hardware
  servers (s390{,x} atm).  (#213026)- Add xorg-x11-server-1.1.1-ia64-int10.patch to not define -DPC_ on
  ia64. Bugs 210149 and 210153.
- Add xorg-x11-server-1.1.1-ia64-pci-chipsets.patch to probe
  ia64 specific chipsets. Bug 210150- graphics-expose.patch: Call miHandleExposures() with non-translated
  coordinates.- Fix over-zealous code deletion in graphics-expose.patch.- xorg-x11-server-1.1.1-graphics-expose.patch: call
  miHandleExposures() in CopyArea/CopyPlane explicitly in cw to
  generate GraphicsExposes correctly. (#209336).- xorg-x11-server-1.1.1-offscreen-pixmaps.patch: Take the server lock
  before calling back into XAA to evict pixmaps (#204810).- xorg-x11-server-1.1.1-vt-activate-is-a-terrible-api.patch: Since the
  VT_ACTIVATE/VT_WAITACTIVE pair are never guaranteed to successfully
  complete, set a 5 second timeout on the WAITACTIVE, and retry the pair
  until we win.  (#207746)
- xorg-x11-server-1.1.0-pci-scan-fixes.patch: Partial revert to unbreak some
  (but not all) domainful machines, including Pegasos. (#207659)- xorg-x11-server-1.1.1-getconfig-pl-die-die-die.patch: Fix XGI cards (#208000)- xorg-x11-server-1.1.1-vbe-filter-less.patch: Be gentler about rejecting
  VESA modes early, since xf86ValidateModes should handle them just fine.- xorg-x11-server-1.1.1-pclose-confusion.patch: Be sure to call Pclose()
  on pipes created with Popen(), since the additional magic done by Popen()
  relative to popen() is not undone by plain pclose().  (Third base!)
- xorg-x11-server-1.1.1-edid-hex-dump.patch: Backport EDID hex dump code
  from git.- Bump xorg-x11-proto-devel BuildRequires version and add Conflict
  line for older mesa releases, so GLX_EXT_texture_from_pixmap opcodes
  match.- xorg-x11-server-1.1.1-believe-monitor-rb-modes.patch: Always believe the
  monitor when it reports a reduced-blanking mode, even over VGA.- Add "built-ins" to default font path.- Enable builtin fallback versions of9j`@Jeremy Katz <katzj@redhat.com>Juan Quintela <quintela@redhat.com>David Woodhouse <dwmw2@redhat.com>Juan Quintela <quintela@redhat.com>Don Zickus <dzickus@redhat.com>Don Zickus <dzickus@redhat.com>Jesse Keating <jkeating@redhat.com>David Woodhouse <dwmw2@redhat.com>Don Zickus <dzickus@redhat.com>Marcelo Tosatti <mtosatti@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Juan Quintela <quintela@redhat.com>Don Zickus <dzickus@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Don Zickus <dzickus@redhat.com>Don Zickus <dzickus@redhat.com>Dave Jones <davej@redhat.com>Juan Quintela <quintela@redhat.com>Juan Quintela <quintela@redhat.com>Juan Quintela <quintela@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Juan Quintela <quintela@anano.mitica>Juan Quintela <quintela@redhat.com>Dave Jones <davej@redhat.com>Jon Masters <jcm@redhat.com>Dave Jones <davej@redhat.com>Jeremy Katz <katzj@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Juan Quintela <quintela@redhat.com>Roland McGrath <roland@redhat.com>Juan Quintela <quintela@redhat.com>Juan Quintela <quintela@redhat.com>Don Zickus <dzickus@redhat.com>Juan Quintela <quintela@redhat.com>Dave Jones <davej@redhat.com>Jeremy Katz <katzj@redhat.com>Dave Jones <davej@redhat.com>Jon Masters <jcm@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Don Zickus <dzickus@redhat.com>Jon Masters <jcm@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Don Zickus <dzickus@redhat.com>Dave Jones <davej@redhat.com>Juan Quintela <quintela@redhat.com>Rik van Riel <riel@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Juan Quintela <quintela@redhat.com>Dave Jones <davej@redhat.com>Juan Quintela <quintela@redhat.com>Juan Quintela <quintela@redhat.com>Rik van Riel <riel@redhat.com>Dave Jones <davej@redhat.com>Jon Masters <jcm@redhat.com>Juan Quintela <quintela@redhat.com>Dave Jones <davej@redhat.com>Jon Masters <jcm@redhat.com>Juan Quintela <quintela@redhat.com>Dave Jones <davej@redhat.com>Juan Quintela <quintela@redhat.com>Jeremy Katz <katzj@redhat.com>Roland McGrath <roland@redhat.com>Juan Quintela <quintela@anano.mitica>Juan Quintela <quintela@redhat.com>Don Zickus <dzickus@redhat.com>Don Zickus <dzickus@redhat.com>Don Zickus <dzickus@redhat.com>Juan Quintela <quintela@redhat>Roland McGrath <roland@redhat.com>Jon Masters <jcm@redhat.com>Jon Masters <jcm@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Don Zickus <dzickus@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Mike Christie <mchristi@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>Roland McGrath <roland@redhat.com>Dave Jones <davej@redhat.com>David Woodhouse <dwmw2@redhat.com>David Woodhouse <dwmw2@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>David Woodhouse <dwmw2@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Don Zickus <dzickus@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>David Woodhouse <dwmw2@redhat.com>Dave Jones <davej@redhat.com>David Woodhouse <dwmw2@redhat.com>Dave Jones <davej@redhat.com>David Woodhouse <dwmw2@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Jeremy Katz <katzj@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>Dave Jones <davej@redhat.com>k,@d@glas
  Gilbert via Tim Waugh- pam_console_apply: muck with devices even if the mount point doesn't exist- pam_console: error out on undefined classes in pam_console config file
- console.perms: actually change the permissions on the new device classes
- pam_console: add an fstab= argument, and -f and -c flags to pam_console_apply
- pam_console: use g_log instead of g_critical when bailing out
- console.perms: logins on /dev/vc/* are also console logins, from Douglas
  Gilbert via Tim Waugh- add pam_console_apply
- /dev/pilot's usually a serial port (or a USB serial port), so revert its
  group to 'uucp' instead of 'tty' in console.perms
- change pam_console's behavior wrt directories -- directories which are
  mount points according to /etc/fstab are taken to be synonymous with
  their device special nodes, and directories which are not mount points
  are ignored- handle errors fork()ing in pam_xauth
- make the "other" config noreplace- user should own the /dev/video directory, not the non-existent /dev/v4l
- tweak pam_limits doc- own /etc/security
- be more descriptive when logging messages from pam_limits
- pam_listfile: remove some debugging code (#28346)- pam_lastlog: don't pass NULL to logwtmp()- pam_listfile: fix argument parser (#27773)
- pam_lastlog: link to libutil- pam_limits: change the documented default config file to reflect the defaults
- pam_limits: you should be able to log in a total of maxlogins times, not
  (maxlogins - 1)
- handle group limits on maxlogins correctly (#25690)- change the pam_xauth default maximum "system user" ID from 499 to 99 (#26343)- refresh the default system-auth file, pam_access is out- actually time out when attempting to lckpwdf() (#25889)
- include time.h in pam_issue (#25923)
- update the default system-auth to the one generated by authconfig 4.1.1
- handle getpw??? and getgr??? failures more gracefully (#26115)
- get rid of some extraneous {set,end}{pw,gr}ent() calls- overhaul pam_stack to account for abstraction libpam now provides- remove pam_radius at request of author- merge to 0.74
- make console.perms match perms set by MAKEDEV, and add some devfs device names
- add 'sed' to the buildprereq list (#24666)- added "exit 0" to the end of the %pre script- self-hosting fix from Guy Streeter- use gcc for LD_L to pull in intrinsic stuff on ia64- take another whack at compatibility with "hash,age" data in pam_unix (#21603)- make the -devel subpackage unconditional- merge/update to 0.73- refresh from CVS -- some weird stuff crept into pam_unix- fix handling of "nis" when changing passwords by adding the checks for the
  data source to the password-updating module in pam_unix
- add the original copyright for pam_access (fix from Michael Gerdts)- redo similar() using a distance algorithm and drop the default dif_ok to 5
- readd -devel- fix similar() function in pam_cracklib (#14740)
- fix example in access.conf (#21467)
- add conditional compilation for building for 6.2 (for pam_userdb)
- tweak post to not use USESHADOW any more- make EINVAL setting lock limits in pam_limits non-fatal, because it's a 2.4ism- revert to DB 3.1, which is what we were supposed to be using from the get-go- add RLIMIT_LOCKS to pam_limits (patch from Jes Sorensen) (#20542)
- link pam_userdb to Berkeley DB 2.x to match 6.2's setup correctly- remove prereq on sh-utils, test ([) is built in to bash- fix the pam_userdb module breaking- fix pam_unix likeauth argument for authenticate(),setcred(),setcred()- tweak pre script to be called in all upgrade cases
- get pam_unix to only care about the significant pieces of passwords it checks
- add /usr/include/db1/db.h as a build prereq to pull in the right include
  files, no matter whether they're in glibc-devel or db1-devel
- pam_userdb.c: include db1/db.h instead of db.h- add BuildPrereq for bison (suggested by Bryan Stillwell)- patch from Dmitry V. Levin to have pam_stack propagate the PAM fail_delay
- roll back the README for pam_xauth to actually be the right one
- tweak pam_stack to use the parentkS,@,,F ?sd	!	Z48PT]d	h~/`/	/
//	G/
	/
X/C/.P/

	
@	
	(89(:FCGd/H /I/JXY\(/]/^
bdIeNfSkUl\tt/u0/v
w/x|/y8{D/AA
  D H/ xK |g h Clibxslt-devel1.1.174.el5_8.3Libraries, includes, etc. to embed the Gnome XSLT engineThis C library allows to transform XML files into other XML files
(or HTML, text, ...) using the standard XSLT stylesheet transformation
mechanism. To use it you need to have a version of libxml2 >= 2.6.25
installed.PRAbuilder10.centos.org̰CentOS-5CentOSMITDevelopment/Librarieshttp://xmlsoft.org/XSLT/linuxx86_64	f	4
7
0?T3
u
b-g
b `	*	jD*hLkɁA큤A큤A큤PR@PR>PR>PR>PR>PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR=PR@PR>PR@PR=PR@PR@PR@PR@PRA>Q<c;KDV~>?A>HC|6C|6DV}=DV}=PR>PR=713857dc5a0553d8b961bc1d6a6e252e06a8b4f33809c521de3f4d72bfcfb4b1c9abb83fc32dd821a9c3a1556d14bcfe079c35b6fa14302aad0764c1dee5780901b61d0248bd6ae4341afd602f366d9faa97b10557c5e9aa6669c2d094bd1ed362ee5a44df1ba0bf7099615c9279d27f59d254c7c6e3fcb9055bfd3b4e9fddcb09b4a851688b5a3e5d853f4d200e86be30854816a2855caf97baf087071a311d86e01775acab3d1b1ca655cd5be9e0f3200d0421cbdcf73ab35ae2c38cdf74a6c84dae8755ec4943fbaa5435598bf046c0d456ca37151d513ee30e933a90e08fe138be2b73996aecd06e7ab683665e6ca7c4550a07d69c562bd476196b157693ee0e0546a0b51c9a286befa6fca93fda4bd1da6bd4738204c0a4e66891050a2126c1fcdd7f18573fa0097dfa21e8a0e32c068893c4dfd592e55a642dbcbc32fbe140832f587ebb140afd93f85742dc09199303251a062d192c3d21e2d7d61f64207ffe4e458a8c24635b3eb24bdd8000aada56666b4be43adcc50832e0cb0ebe3bc37e281b9adb756a79a7ef53b13cc3377019e790eaf14b33213f14c24e36ea6228111907586866fc17f122981327857481c4cff4bbc75e78f97781392c8468f57f984e5620a3bbc045dfc5cc6c19d27b0b8b6bd86eea30c617663c9e9439b34642f8b0ba8cd6550f49fa0bcb772ddb0cd9a07afbeb24026c9b03aecfeba45802ac7d6ab1b984c0e81c380ac3ff88aadd06c392622ca1fd18235ca32f21d503752be61185160241c964eb1b63c5097a1671e62be479162b8d9a012c81bc235ecd99b9297209a5cadd94901423414a29f4a36c6732c4beb28bbb666a89d37577b4b96197175832addb1d8e2ebf00c5a4e3715aec192bffc20f1803962bb667e512eb7b73f7629cf7d6a8bdb49b8e94f44bb3b8f2ab6f3d479952fb93d9ff87c2libexslt.so.0.8.13libxslt.so.1.1.17rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootxkcv	@v	w	u	edhat.com>Jeremy Katz <katzj@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeremy Katz <katzj@redhat.com>Erik Troan <ewt@redhat.com>- grub-install: fix regex for partition and multipath when
  use_friendly_names is off
  Resolves: rhbz#1034595- Fix build error with "savedefault" fix.
  Resolves: rhbz#212649- Handle devices beyond sdaa
  Resolves: rhbz#782096- Update documentation for "savedefault" grub-shell command
  Resolves: rhbz#212649
- Support more than 10 devices
  Resolves: rhbz#829228- Fix a bad path name in the patch...
  Resolves: rhbz#464178- Copy the kernel and initrd using a smaller buffer to avoid using memory
  we can't correctly map
  Resolves: rhbz#464178- Don't assume that gcc provides us with writable strings in the xfs driver
  Resolves: rhbz#496949- Allow grub-install to work on virtio_blk devices (patch from markmc)
  Resolves: rhbz#498388- Update patch for CCISS to not break some device mapper rules.
  Resolves: rhbz#429187- Fix handling of CCISS devices when installing to the MBR.
  Resolves: rhbz#429187
- Allow longer kernel command lines
  Resolves: rhbz#336341- rebuilt for unwind info generation, broken in gcc-4.1.1-21- Reenable patch 505, which fixes #116311- Disable patch 505 (#164497)- Fix grub-install for multipath- rebuild- fix broken error reporting from helper functions- Fix BIOS keyboard handler to use extended keyboard interrupts, so the
  Mac Mini works.- Added BuildRequires on a 32bit library- Fix mactel keyboard problems, patch from Juergen Keil, forwarded by Linus.- Fix merge error for "bootonce" patch (broken in 0.95->0.97 update)
- Get rid of the 0.97 "default" stuff, since it conflicts with our working
  method.- Fix running "install" multiple times on the same fs in the same invocation
  of grub.  (bz #158426 , patch from lxo@redhat.com)- fix partition names on dmraid- rebuilt for new gcc4.1 snapshot and glibc changes- add dmraid support- update to grub 0.97- fix configure conftest.c bugs
- add -Wno-unused to defeat gcc41 "unused" checking when there are aliases.- minor fix to the --recheck fix.- Make "grub-install --recheck" warn the user about how bad it is,
  and keep a backup file, which it reverts to upon detecting some errors.- Fix changelog to be UTF-8- Make the spec work with gcc3 and gcc4, so people can test on existing
  installations.
- don't treat i2o like a cciss device, since its partition names aren't done
  that way. (#158158)- Make installing on a partition work again when not using raid- Make it build with gcc4- Always install in MBR for raid1 /boot/- Always use full path for mdadm in grub-install- Mark the simulation stack executable
- Eliminate the use of inline functions in stage2/builtins.c- Make grub ignore everything before the XPM header in the splash image,
  fixing #143879
- If the boot splash image is missing, use console mode instead 
  of graphics mode.
- Don't print out errors using the graphics terminal code if we're not
  actually in graphics mode.- reworked much of how the RAID1 support in grub-install works.  This version
  does not require all the devices in the raid to be listed in device.map,
  as long as you specify a physical device or partition rather than an md
  device.  It should also work with a windows dual-boot on the first partition.- added support for RAID1 devices to grub-install, partly based on a
  patch from David Knierim. (#114690)- add patch from upstream CVS to handle sparse files on ext[23]
- make geometry detection a little bit more robust/correct
- use O_DIRECT when reading/writing from devices.  use aligned buffers as 
  needed for read/write (#125808)
- actually apply the i2o patch
- detect cciss/cpqarray devices better (#123249)- don't act on the keypress for the menu (#134029)- add patch from Nicholas Miell to make hiddenmenu work more 
  nicely with splashimage mode (#126764)- update to 0.95
- drop emd patch, E-MD isn't making forward progress upstream
- fix static build for x86_64 (#121ip^=@RRRR	R
RRRRRRRRRRRRRRR	R
RRR
RRRRRRRR
R
RRRRRRR	R
RRRRRRR	R
RR
RRRRRRRR	R
RR
RRRRRRRRR	RRRRRRR	RRRRRRR	R
RR
RRRRRRRRR	R
RR
RRRRRRRRR	R
RR
RRRRRRR
R
RRRRRRR	R
RR
RRRRRRR
R
RRRRR
R
RRRRR	RRRRRRRRRR?@
2
W8O>EE?T*GV(S1"IZJ5{-U"TYb@ֱUұ
h$fJ?T*GV(ŴZOFDq
x1,ssv4Nj6dc928160174cd31ab9836e7294251b649af2af0\<o@\<afafamamangangararasasazazazazbebebgbgbnbnbnbnbrbrbsbscacacscscycydadadededzdzeleleneneneneseseteteueufafafififrfrgagaglglguguhehehihihrhrhuhuhyhyiaiaididisisititjajakakakokokukulililtltlvlvmimimkmkmlmlmnmnmrmrmsmsnbnbnenenlnlnnnnnsonsoororpapaplplptptptptrororururwrwsisiskskslslsqsqsrsrsr@Latnsr@Latnsr@ijesr@ijesvsvtatateteththtktktrtrttttukukururuzuzuz@Latnuz@Latnviviwawaxhxhyiyizhzhzhzhzhzh2.10.4-21.el5_5.6														







  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkklmnloplqrgtk-2.0x86_64-redhat-linux-gnugdk-pixbuf.loadersgtk.immodulesgdk-pixbuf-query-loaders-64gtk-demogtk-query-immodules-2.0-64gtk-update-icon-cacheupdate-gdk-pixbuf-loadersupdate-gtk-immodulesgtk-2.02.10.0engineslibpixmap.soimmodulesim-am-et.soim-cedilla.soim-cyrillic-translit.soim-inuktitut.soim-ipa.soim-thai-broken.soim-ti-er.soim-ti-et.soim-viqr.soim-xim.soloaderslibpixbufloader-ani.solibpixbufloader-bmp.solibpixbufloader-gif.solibpixbufloader-ico.solibpixbufloader-jpeg.solibpixbufloader-pcx.solibpixbufloader-png.solibpixbufloader-pnm.solibpixbufloader-ras.solibpixbufloader-tga.solibpixbufloader-tiff.solibpixbufloader-wbmp.solibpixbufloader-xbm.solibpixbufloader-xpm.soprintbackendslibprintbackend-cups.solibprintbackend-file.solibprintbackend-lpr.soimmodules.relocation-taglibgdk-x11-2.0.so.0libgdk-x11-2.0.so.0.1000.4libgdk_pixbuf-2.0.so.0libgdk_pixbuf-2.0.so.0.1000.4libgdk+@++,o.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.2.5)(64bit)libdl.so.2()(64bit)libglib-2.0.so.0()(64bit)libgmodule-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libldap-2.3.so.0()(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpam_misc.so.0()(64bit)libpam_misc.so.0(LIBPAM_MISC_1.0)(64bit)libpopt.so.0()(64bit)libselinux.so.1()(64bit)libuser.so.1()(64bit)python(abi)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)0.54.7-3.el52.43.0.4-14.0-14.4.2.3OM*JJq@GG@GZ@G^{Fzh@EnEED@DDU@CCtC@CCqC7@CtCtCK@CC@C&@BBss@Bk@B_BS@BJB)@AA@AHA_AvAk@Ai$@AZAYR@AXAXAT@ARA8\A4h@A,@@@?P?\o@?0>Sq>R @>BN@>@>=(=ki=><@<@<@<<<@<V@<m@<~<z'@<t@<s<nI<jU@<Y1<V<V<U=@<O@<O@<F<Ek@<9;@;@;;6@;M@;M@;;zd@;y;w@;r{@;o@;i@;i@;g@;f;eL@;aW;`@;^;]c@;\;X@;V;Uz@;T(;R@;L?;J@;E@;1;-@;);(@;'U;&@;#a@; @;l;@;;;@::@:S:i}:\N:S@:QMiloslav Trmač <mitr@redhat.com> - 0.54.7-3Miloslav Trmač <mitr@redhat.com> - 0.54.7-3Miloslav Trmač <mitr@redhat.com> - 0.54.7-3Miloslav Trmač <mitr@redhat.com> - 0.54.7-2.el5.7Miloslav Trmač <mitr@redhat.com> - 0.54.7-2.el5.6Miloslav Trmač <mitr@redhat.com> - 0.54.7-2.el5.5Miloslav Trmač <mitr@redhat.com> - 0.54.7-2.el5.4Miloslav Trmač <mitr@redhat.com> - 0.54.7-2.el5.3Miloslav Trmač <mitr@redhat.com> - 0.54.7-2.el5.2Miloslav Trmac <mitr@redhat.com> - 0.54.7-2.el5.1Jesse Keating <jkeating@redhat.com> - 0.54.7-2Miloslav Trmac <mitr@redhat.com> - 0.54.7-1Jesse Keating <jkeating@redhat.com> - 0.54.6-2.1Miloslav Trmac <mitr@redhat.com> - 0.54.6-2Miloslav Trmac <mitr@redhat.com> - 0.54.6-1Miloslav Trmac <mitr@redhat.com> - 0.54.5-1Miloslav Trmac <mitr@redhat.com> - 0.54.4-1Jesse Keating <jkeating@redhat.com> - 0.54.3-1.2.1Jesse Keating <jkeating@redhat.com> - 0.54.3-1.2Jesse Keating <jkeating@redhat.com>Miloslav Trmac <mitr@redhat.com> - 0.54.3-1Miloslav Trmac <mitr@redhat.com> - 0.54.2-1Miloslav Trmac <mitr@redhat.com> - 0.54.1-2Miloslav Trmac <mitr@redhat.com> - 0.54.1-1Matthias Clasen <mclasen@redhat.com> - 0.54-2Miloslav Trmac <mitr@redhat.com> - 0.54-1Miloslav Trmac <mitr@redhat.com> - 0.53.8-1Miloslav Trmac <mitr@redhat.com> - 0.53.7-1Miloslav Trmac <mitr@redhat.com> - 0.53.6-1Miloslav Trmac <mitr@redhat.com> - 0.53.5-1Miloslav Trmac <mitr@redhat.com> - 0.53.4-1Miloslav Trmac <mitr@redhat.com> - 0.53.3-2Miloslav Trmac <mitr@redhat.com> - 0.53.3-1Miloslav Trmac <mitr@redhat.com> - 0.53.2-1Miloslav Trmac <mitr@redhat.com> - 0.53.1-1Miloslav Trmac <mitr@redhat.com> - 0.53-1Jeremy Katz <katzj@redhat.com> - 0.52.6-2Miloslav Trmac <mitr@redhat.com> - 0.52.6-1Miloslav Trmac <mitr@redhat.com> - 0.52.5-1Miloslav Trmac <mitr@redhat.com> - 0.52.4-1Miloslav Trmac <mitr@redhat.com> - 0.52.3-1Miloslav Trmac <mitr@redhat.com> - 0.52.2-1Miloslav Trmac <mitr@redhat.com> - 0.52.1-1Miloslav Trmac <mitr@redhat.com> - 0.52-1Miloslav Trmac <mitr@redhat.com> - 0.51.12-1Miloslav Trmac <mitr@redhat.com> - 0.51.11-1Miloslav Trmac <mitr@redhat.com> - 0.51.10-1Miloslav Trmac <mitr@redhat.com> - 0.51.9-1Miloslav Trmac <mitr@redhat.com> - 0.51.8-1Dan Walsh <dwalsh@redhat.com> 0.51.7-7Jeremy Katz <katzj@redhat.com> 0.51.7-6Dan Walsh <dwalsh@redhat.com> 0.51.7-5Dan Walsh <dwalsh@redhat.com> 0.51.7-3Nalin Dahyabhai <nalin@redhat.com> 0.51.7-1Nalin Dahyabhai <nalin@redhat.com> 0.51.6-1Nalin Dahyabhai <nalin@redhat.com> 0.51.5-2Nalin Dahyabhai <nalin@redhat.com> 0.51.5-1Nalin Dahyabhai <nalin@redhat.com> 0.51.4-1Nalin Dahyabhai <nalin@redhat.com> 0.51.2-1Nalin Dahyabhai <nalin@redhat.com> 0.51.1-2Nalin Dahyabhai <nalin@redhat.com> 0.51.1-1Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.51-1Nalin Dahyabhai <nalin@redhat.com> 0.50.2-1Nalin Dahyabhai <nalin@redhat.com> 0.50-1DjoMb@bcatdev earlier (Jiri Pirko) [770813]
- [fs] nfs: Fix bugs on short read (Sachin Prabhu) [924011]
- [fs] nfs: Don't allow NFS silly-renamed files to be deleted (Dave Wysochanski) [906472]
- [xen] AMD IOMMU: spot missing IO-APIC entries in IVRS table (Igor Mammedov) [910913] {CVE-2013-0153}
- [xen] AMD, IOMMU: Make per-device interrupt remap table default (Igor Mammedov) [910913] {CVE-2013-0153}
- [xen] AMD, IOMMU: Disable IOMMU if SATA Combined mode is on (Igor Mammedov) [910913] {CVE-2013-0153}
- [xen] AMD, IOMMU: On creating entry clean up in remapping tables (Igor Mammedov) [910913] {CVE-2013-0153}
- [xen] ACPI: acpi_table_parse() should return handler's err code (Igor Mammedov) [910913] {CVE-2013-0153}
- [xen] introduce xzalloc() & Co (Igor Mammedov) [910913] {CVE-2013-0153}- [x86] fpu: fix CONFIG_PREEMPT=y corruption of FPU stack (Prarit Bhargava) [731531]
- [i386] add sleazy FPU optimization (Prarit Bhargava) [731531]
- [x86-64] non lazy 'sleazy' fpu implementation (Prarit Bhargava) [731531]
- [net] be2net: fix calling __vlan_put_tag() after eth_type_trans() (Ivan Vecera) [916640]
- [net] be2net: increment/decrement vlans_added only once (Ivan Vecera) [922223]
- [net] tg3: use PCI PM core funcs not direct access to registers (Ivan Vecera) [866822]
- [fs] ext3: fix update of mtime and ctime on rename (Carlos Maiolino) [919191]
- [fs] nfs: handle getattr failure during nfsv4 open (David Jeffery) [906909]
- [pci] read-modify-write PCIe dev control reg when initiating FLR (Myron Stowe) [854001]
- [fs] ext3: fix wrong gfp type under transaction (Lukas Czerner) [816665]
- [pci] intel-iommu: Prev devs with RMRRs from going in SI Domain (Tony Camuso) [839334]
- [net] tcp: fix >2 iw selection (Daniel Borkmann) [871787]
- [ata] sata_svw: check DMA start bit before reset (David Milburn) [754311]
- [s390] qeth: set new mac even if old mac is gone (Hendrik Brueckner) [883459]
- [s390] qeth: fix deadlock between recovery and bonding driver (Hendrik Brueckner) [869646]
- [s390] dasd: check count address during online setting (Hendrik Brueckner) [859527]
- [s390] hugetlb: use direct TLB flushing for hugetlbfs pages (Hendrik Brueckner) [861178]- [virt] xen-netback: backports (Andrew Jones) [910885] {CVE-2013-0216 CVE-2013-0217}
- [virt] xen-netback: netif_schedulable should take a netif (Andrew Jones) [910885] {CVE-2013-0216 CVE-2013-0217}
- [virt] pciback: rate limit error mess from pciback_enable_msi() (Igor Mammedov) [910877] {CVE-2013-0231}
- [net] be2net: remove BUG_ON() in be_mcc_compl_is_new() (Ivan Vecera) [907524]
- [net] ipv4: Update MTU to all related cache entries (Amerigo Wang) [905190]
- [net] annotate rt_hash_code() users (Amerigo Wang) [905190]
- [net] xfrm_user: fix info leak in copy_to_user_state() (Thomas Graf) [922427] {CVE-2012-6537}
- [net] xfrm_user: fix info leak in copy_to_user_policy() (Thomas Graf) [922427] {CVE-2012-6537}
- [net] xfrm_user: fix info leak in copy_to_user_tmpl() (Thomas Graf) [922427] {CVE-2012-6537}
- [net] atm: fix info leak in getsockopt(SO_ATMPVC) (Thomas Graf) [922385] {CVE-2012-6546}
- [net] atm: fix info leak via getsockname() (Thomas Graf) [922385] {CVE-2012-6546}
- [net] tun: fix ioctl() based info leaks (Thomas Graf) [922349] {CVE-2012-6547}
- [net] llc, zero sockaddr_llc struct (Thomas Graf) [922329] {CVE-2012-6542}
- [net] llc: fix info leak via getsockname() (Thomas Graf) [922329] {CVE-2012-6542}
- [net] xfrm_user: return error pointer instead of NULL (Thomas Graf) [919387] {CVE-2013-1826}
- [kernel] wait_for_helper: SIGCHLD from u/s cause use-after-free (Frantisek Hrbata) [858753] {CVE-2012-4398}
- [kernel] Fix ____call_usermodehelper errs being silently ignored (Frantisek Hrbata) [858753] {CVE-2012-4398}
- [kernel] wait_for_helper: remove unneeded do_sigaction() (Frantisek Hrbata) [858753] {CVE-2012-4398}
- [kernel] kmod: avoid deadlock from recursive kmod call (Frantisek Hrbata) [858753] {CVE-2012-4398}
- [kernel] kmod: make request_module() killable (Frantisek Hrbata) [858753] {CVE-2012-4398}
- [net] ixgbevf: allocate room for mailbox MSI-X interruk@b6915583c36e46acb23371947e50eefd226ad0ec5f1ece56e58f2689cfffe8b8df320a4a07e2d091534a1ec2d555ecbdcf9cc21259a81b98e98785c1f5a195e95a9b689a78d222c32d9efbfba7ac0a617230c6c87389bb5932a4aac73162a419499ec9129d5b19221347527b3695a6fd8a9fce6c98531f07afc3fe3543f9e4f9f725c9f98e97b63c8ab0b6685656da9f10d5ea93e2dba99ce892e1e9d4d9d9e10539c0d7ccc13f38dcfb5897bd6c082b269062fce2681dbeef69a58ce2d15a68da11d1ebd2055217e733e681d0e4e25b4e3b897931bfd7526c4ccba7fdaebdf134cc7c9c40110ef8e43d913ffcd47e19ec7ec8c461f04a354179acf5c12454b89662e4ee0aea4bb003e4cbfc78b062b1d76897edf7d7dfa090589fc6cf30cbfa679ce1e57b2ab3b55f3f0dfddb9253881078245834cccc349b914d0346a1778e6ec2ab0a6b9e53af9fe8f4ea5a02a02527530e2decf89246e1b6414e170f65741193306c82dde45f679e1f473e8f31e054dc3ee12963b3f3436cde32b9e0d7523da59876a70e41613c17bfd09c4f8e983a1076514e040b1b567ee97ec2c49bd9b29218c8f95453d0ddfa95909458cf09cceba942462687c38d86efe6fc66b9f9030348310a7738900f865ffa5a36d3eca82c47ffd858c206f514005486421008d76d3206652439e3e6ec55de86780f4ba45cb32a449ba62936ff94fb40df468e96a34761332faa5c3f0680f371ed1c92be3b12a1048f6e204b4578bf56ef489f1c7da1d78de399e9fc790246d97cdd366fa54bb2232db90c646c806713c197306c6bb47477f8eb75defec0a58758f730e94a0b2d2f65e33cf43d3b948ada98d67fc51bec08e9733706b5bb3331a9d9e5bd85ea5fe4dcbca135e38d12efe748e05e6882d4b0d91cd10abc892edb9cd2c63c393a12b52faa5a1152da5ddd2cef565f7d9b3729fa0e703a7b6688beb0207958d2c4a57296003ee2b0d11cccf6629d9f94ddfe7d632ced39136305c8611ae56488a9cf798e9b258d1e536b70ae4b1271267cc7853a4df80d7ba58af8bc765d296ad4032a93feefe65b62e868b8bb62c3a3c3f1c8c96057f930e89c76469da5e83a4659418e52b319aff2705bb9e35f655507c42d7717bdf691ccb01350fdc45a74c5d308a67d7a6c6aa565ea78ae40eded9b7b4f0b376f8dff19e484feb6ca0856b64cfa0b1706f854d4a0804d999819c536639167546041788d1f041ec585cbb5480f881a749f0f71c74ed38ff7867e69aa18ab304062b8d1074e61bda108ab1f15c6f8f1617f48747c6b959d4e44240940b47d70eb1519c5ea452bb3fb7cba04b1f5e28f03344ee67284b0583f9cc28f82d785d570007906caf8695fc54cfb002c96f3f1548a874aef72820441a68de1fd1f12e51aad2b7df324da6e305c906d31fdf1e7f7933fea6405f507794d8ee7d9d2ab0a87c8d974457dd278d94f700c61984cd843abd932e8a6e4fd78bf1e851999a9ce367ce77100cee973a756032ffc5bfac43215578b93bbddb5a0c2c155a88e1bec1ca71fe9fa778670cd400bf228859e4e39e76d6a4065f39dbb6e7169cdaf130d93042d949c61b10a8ea1f1453a048e4316a19bbd0fd80c4f817cb9e041cdee55395774a1fc5dca047653e944ae356dbb328dddc9dac84c3a9c4ca72169d3f5faea0839ea5594865391a927cae3ab9db4ee01d5416ad1505e97ca8d20fed45250e2743f0ad36142b584054885cff3b118e7c3bd4a883de569567f95441e51e7e9f4541f8d2a4f85855649334fa56ea197587d0db0654459b061df0506a613cdc829d6192a63502c403db3a426f543172ec383b9e738c95ac96972a3517f723df2ff46831509a1f827a27ee4ef43db66aed0edaa2f92df84778a7ab6f45a8b409245b2dffd5f12f7a2e8bf5c1b37971fa5b78b0cebcedd797b4340e58058fd9abf50b9cdfbb3923c2c22bd645ad45c9467e36c76dbc5a8318e64b20fccb920de1ce4b93b437d3b8a41a9966b06a0027647cbe0893eeaa9fc4621d2505e2dbb5778587b816037f336f31de4a9c0af722bc928a928cc9168606a6f5c8b1e3bfe90ac768f95d55e0401928e93f039f1f82699473f5e80b77d76c8f446705ee8765fd1c250b6032cc748d28343939d22ecbaf9e1c992fe643c86bad544a955727f62d3658a924e446a3d1fc99fc41550d1d84feb1b098d4ba71101bf73c91bc7fa5049113df98e9385e1f5ec94a1fd25e5a15974cf4b00f128968a36d1a9694a151717034c0a3548940f761917beede9244bcad3426f7b29042a8605b713f067b1ee0713991780b9c7684c2e97115cf43bce9368208e15e906a4f95a9120a5ee82f2e48b83fc29a7e282fa165895b1131bb1ed9df88d146785ca82b75938ff086d87ff7b156ea71037e54fe736b0ae11c00a826a7275ef2849a6aa8dfe32fbd7273afee6fc62a61901f6575fd64133cc4f9fb7fa9550e17050dee1e696b4b8da2bfea0c5c69d1bbdeb1211fb7babc95b51f658edd8f1f310a3165e99d7ead186b4abf63e55ec3d6df5537f7943f50baaa8a4ad85b28bfae6de4cb720fcb1bd46a205792a4c21800b02ec60c0fabcd230039eddf31122ebae839b94184d5e4c8b5eea08eb12bf79f2889be4dbc67b991c549a540c4424d49f7c78b4bd7540db5db29e6fa34646c6962175dc6be1ec0eb809c15d41110873f8ce3e191eae952532e71de22730dd11e1e2e86b478ba557802ffdcaa841b64e50b12ec1d8735635a663f8ae16075355e92dc01b039ff7086f3e077l.@...l Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Matt Wilson <msw@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Prospector <bugzilla@redhat.com>Florian La Roche <laroche@redhat.com>Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Doug Ledford <dledford@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Jakub Jelinek <jakub@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Matt Wilson <msw@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Jakub Jelinek <jj@ultra.linux.cz>Michael FulbrightErik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Rebuild for rpmdiff errors
- Related: #708458- Remove stale weak-update links
- Resolves: #708458- Revert a previous patch that broke certain kmod upgrades.
- Resolves: #593504- Correct a problem with upgrading Driver Updates not updating symlinks.
- Resolves: #638855- Add SYSV locking in the case of a read-only filesystem.
- Resolves: #430942
- Do not create Xen grub boot entries for a running domU.
- Resolves: #509568
- Do not re-link compatible module when also removing it.
- Resolves: #477089- Fix rpmsort to properly convert .. back to - globally.
- Related: #404311- Ignore "install" directives on "--show-depends".
- Resolves: #497923- Fix trivial bug in patch for #430942 caused by upstream bad formatting
- Resolves: #430942- Update weak-modules script to use newer logic on add_modules to
- avoid occasional creation of needless subdirectories.
- Resolves: #484762- Add a documentation fix for depmod adding the 'a' option.
- Resolves: #475549- Replace rpmsort implementation with much simpler/cleaner one.
- Resolves: #404311- Correct use of 'nm' to avoid unnecessary warning messages.
- Also add a dependency on binutils and mkinitrd.
- Resolves: #463777- Parse the kernel command line passed module loading paramters.
- Resolves: #487395.- Abort loading a module if one if its dependents fails to load
- Resolves: #430942.- Don't print noisy warnings when loading multiple aliases
- Resolves: #458134.- Allow more precise wildcard matching of kernel versions
- Resolves: #460046.- Make modprobe operate in nonblocking mode by default
- Resolves: #280411.
- Add a --delete-modules to weak-modules to avoid linking compat
- Resolves: #432959.- Sort modules alphabetically.
- Resolves: #249449.
- Check override of modules.
- Resolves: #253512.
- Fix "--dry-run" option.
- Resolves: #254141.- Update to fix inter-module symbol references on 64-bit platforms.
- (fix wasjP@me (Steve Best) [565570]
- [scsi] ibmvfc: Fix soft lockup on resume (Steve Best) [565570]
- [scsi] ibmvfc: Add suspend/resume support (Steve Best) [565570]
- [scsi] ibmvscsi: Add suspend/resume support (Steve Best) [565570]
- [net] ibmveth: Add suspend/resume support (Steve Best) [565570]
- [ppc] vio: add power management support (Steve Best) [565570]
- [ppc] add hooks to put CPU in appropriate offline state (Steve Best) [565570]
- [virt] xen: fix passthrough of SR-IOV VF (Paolo Bonzini) [582886]
- [mm] add option to skip ZERO_PAGE mmap of /dev/zero (Larry Woodman) [619541]
- [net] bonding: check if clients MAC addr has changed (Flavio Leitner) [610234]
- [virt] xen: fix pud_present compile warnings (Don Zickus) [590760]
- [xen] CPU synchronization during MTRR register update (Don Dugger) [594546]- [pci] fix remove of proc entry for hotplug devices (Wade Mealing) [618114]
- [ide]: atiixp: no pio autotune on AMD Hudson2 (Prarit Bhargava) [618075]
- [pci] msi: add option for lockless interrupt mode (Prarit Bhargava) [599295]
- [virt] xenbus: implement O_NONBLOCK (Paolo Bonzini) [470801]
- [net] ip4v/tcp: no additional reset on closed sockets (Neil Horman) [605259]
- [misc] xen: fix migration using xen-vnif in smp hvm guest (Miroslav Rezanina) [555910]
- [edac] fix i7core_edac in multi-socket systems (Mauro Carvalho Chehab) [468877]
- [net] arp_tables: fix unaligned accesses (Jiri Pirko) [582268]
- [fs] ext3: handle journal_start failure properly (Josef Bacik) [588599]
- [misc] handle dead hung uninterruptible tasks correctly (Jerome Marchand) [582237]
- [fs] ecryptfs: fix ecryptfs_uid_hash buffer overflow (Jerome Marchand) [611387] {CVE-2010-2492}
- [infiniband] check local reserved ports (Jerome Marchand) [557884]
- [infiniband] randomize local port allocation (Jerome Marchand) [557884]
- [net] reserve ports for apps using fixed port numbers (Jerome Marchand) [557884]
- [kernel] sysctl: add proc_do_large_bitmap (Jerome Marchand) [557884]
- [scsi] lpfc: use kernel-provided random32 (Jarod Wilson) [605816]
- [lib] make tausworthe random32 generator available to all (Jarod Wilson) [605816]
- [net] be2net: increase POST timeout for EEH recovery (Ivan Vecera) [616512]
- [hwmon] coretemp: get TjMax value from MSR (Dean Nelson) [580699]
- [hwmon] coretemp: detect the thermal sensors by CPUID (Dean Nelson) [580699]
- [fs] xfs: rename XFS_IGET_BULKSTAT to XFS_IGET_UNTRUSTED (Dave Chinner) [607032]
- [fs] xfs: validate untrusted inode numbers during lookup (Dave Chinner) [607032]
- [fs] xfs: always use iget in bulkstat (Dave Chinner) [607032]
- [s390] qeth: support for OSA CHPID types OSX and OSM (Hendrik Brueckner) [599644]
- [s390] qeth: don't allow layer switch with open interface (Hendrik Brueckner) [612195]
- [s390] zfcp: fix reference counting on adisc (Hendrik Brueckner) [610089]
- [s390] kernel: initrd vs bootmem bitmap (Hendrik Brueckner) [610837]
- [s390] hypfs: fix high cpu time output (Hendrik Brueckner) [589282]
- [s390] dasd: fix race between tasklet and dasd_sleep_on (Hendrik Brueckner) [593756]
- [s390] cmm: fix module unload handling (Hendrik Brueckner) [598549]
- [fs] gfs: clean up stuffed file data copy handling (Abhijith Das) [580867]- [scsi] ips driver sleeps while holding spin_lock (Steve Best) [616961]
- [net] fix lockups and dupe addresses w/bonding and ipv6 (Shyam Iyer) [516985]
- [scsi] megaraid_sas: update driver to version 4.31 (Tomas Henzl) [564249]
- [scsi] megaraid_sas: update driver to version 4.27 (Rob Evers) [564249]
- [net] nat: avoid rerouting packets if only key changed (Jiri Pirko) [566144]
- [fs] cifs: remove bogus check in NTLM session setup code (Jeff Layton) [479418]
- [ata] ahci: add em_buffer attribute for AHCI hosts (David Milburn) [568364]
- [scsi] qla4xxx: add support for ISP82XX (Chad Dupuis) [546592]
- [scsi] qla4xxx: Fixes from upstream for 5.6 (Chad Dupuis) [546592]
- [scsi] qla2xxx: more upstream updates for RHEL 5.6 (Chad Dupuis) [567428]
- [scsi] qla2xxx: add support for ISP82XX (Chad Dupuis) [567428]
- [scsi] qla2xxx: more updates from upstream for R%k@\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\]]]]]]]]]]]]]]]]]]]]^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^vimrcxxdvim-common-7.0.109Changelog.rpmREADME.txtREADME_lang.txtREADME_src.txtREADME_unix.txtdocsfrfr.ISO8859-1man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzfr.UTF-8man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzman1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzitit.ISO8859-1man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzit.UTF-8man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzman1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzex.1.gzrvi.1.gzrview.1.gzvi.1.gzview.1.gzvim.1.gzxxd.1.gzplpl.ISO8859-2man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzpl.UTF-8man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzman1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzru.KOI8-Rman1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzru.UTF-8man1evim.1.gzex.1.gzrview.1.gzrvim.1.gzview.1.gzvim.1.gzvimdiff.1.gzvimtutor.1.gzxxd.1.gzvimvim70autoloadREADME.txtccomplete.vimcsscomplete.vimgzip.vimhtmlcomplete.vimjavascriptcomplete.vimnetrw.vimnetrwFileHandlers.vimnetrwSettings.vimpaste.vimphpcomplete.vimpythoncomplete.vimrubycomplete.vimspellfile.vimsqlcomplete.vimsyntaxcomplete.vimtar.vimvimball.vimxmlhtml32.vimhtml401f.vimhtml401s.vimhtml401t.vimhtml40f.vimhtml40s.vimhtml40t.vimxhtml10f.vimxhtml10s.vimxhtml10t.vimxhtml11.vimxsl.vimxmlcomplete.vimzip.vimbugreport.vimcolorsREADME.txtblue.vimdarkblue.vimdefault.vimdelek.vimdesert.vimelflord.vimevening.vimkoehler.vimmorning.vimmurphy.vimpablo.vimpeachpuff.vimron.vimshine.vimslate.vimtorte.vimzellner.vimcompilerREADME.txtant.vimbcc.vimbdf.vimcheckstyle.vimcs.vimdot.vimeruby.vimfortran_F.vimfortran_cv.vimfortran_elf90.vimfortran_g77.vimfortran_lf95.vimfpc.vimgcc.vimhp_acc.vimicc.vimintel.vimirix5_c.vimirix5_cpp.vimjavac.vimjikes.vimmcs.vimmips_c.vimmipspro_c89.vimmipspro_cpp.vimmodelsim_vcom.vimmsvc.vimneato.vimonsgmls.vimpbx.vimperl.vimphp.vimpyunit.vimrst.vimruby.vimrubyunit.vimse.vimsplint.vimtcl.vimtex.vimtidy.vimxmllint.vimxmlwf.vimdelmenu.vimdocarabic.txt.gzautocmd.txt.gzchange.txt.gzcmdline.txt.gzdebug.txt.gzdebugger.txt.gzdevelop.txt.gzdiff.txt.gzdigraph.txt.gzediting.txt.gzeval.txt.gzfarsi.txt.gzfiletype.txt.gzfold.txt.gzgetscript.txt.gzgui.txt.gzgui_w16.txt.gzgui_w32.txt.gzgui_x11.txt.gzhangulin.txt.gzhebrew.txt.gzhelp.txthowto.txt.gzif_cscop.txt.gzif_mzsch.txt.gzif_ole.txt.gzif_perl.txt.gzif_pyth.txt.gzif_ruby.txt.gzif_sniff.txt.gzif_tcl.txt.gzindent.txt.gzindex.txt.gzinsert.txt.gzintro.txt.gzmap.txt.gzmbyte.txt.gzmessage.txt.gzmlang.txt.gzmotion.txt.gznetbeans.txt.gzoptions.txt.gzos_390.txt.gzos_amiga.txt.gzos_beos.txt.gzos_dos.txt.gzos_mac.txt.gzos_mint.txt.gzos_msdos.txt.gzos_os2.txt.gzos_qnx.txt.gzos_risc.txt.gzos_unix.txt.gzos_vms.txt.gzos_win32.txt.gzk`@'s service name when calling the substack- create /etc/sysconfig/authconfig at install-time if upgrading- modify the files list to make sure #16456 stays fixed
- make pam_stack track PAM_AUTHTOK and PAM_OLDAUTHTOK items
- add pam_chroot module
- self-hosting fixes from the -devel split
- update generated docs in the tree- split off a -devel subpackage
- install the developer man pages- build libraries before modules- fix problems when looking for headers in /usr/include (#17236)
- clean up a couple of compile warnings- give users /dev/cdrom* instead of /dev/cdrom in console.perms (#16768)
- add nvidia control files to console.perms- add DRI devices to console.perms (#16731)- move pam_filter modules to /lib/security/pam_filter (#16111)
- add pam_tally's application to allow counts to be reset (#16456)
- move README files to the txts subdirectory- add a postun that runs ldconfig
- clean up logging in pam_xauth- make the tarball include the release number in its name- add a broken_shadow option to pam_unix
- add all module README files to the documentation list (#16456)- fix pam_stack debug and losing-track-of-the-result bug- rework pam_console's usage of syslog to actually be sane (#14646)- take the LOG_ERR flag off of some of pam_console's new messages- add pam_localuser- need to make pam_console's checking a little stronger
- only pass data up from pam_stack if the parent didn't already define it- automatic rebuild- make pam_console's extra checks disableable
- simplify extra check to just check if the device owner is root
- add a debug log when pam_stack comes across a NULL item
- have pam_stack hand items up to the parent from the child- fix installation of pam_xauth man pages (#12417)
- forcibly strip helpers (#12430)
- try to make pam_console a little more discriminating- symlink libpam.so to libpam.so.0.99.6.2, and likewise for libpam_misc
- reverse order of checks in _unix_getpwnam for pam_unix- include gpmctl in pam_console- add MANDIR definition and use it when installing man pages- handle scanner and cdwriter devices in pam_console- add account management wrappers for pam_listfile, pam_nologin, pam_securetty,
  pam_shells, and pam_wheel- add system-auth control file
- let gethostname() call in pam_access.c be implicitly declared to avoid
  conflicting types if unistd.c declares it- fix problems compiling on Red Hat Linux 5.x (bug #11005)- fix size assumptions in pam_(pwdb|unix) md5 code- Add new pam_stack module.
- Install pwdb_chkpwd and unix_chkpwd as the current user for non-root builds- Fix pam_xauth bug #6191.- Add a patch to accept 'pts/N' in /etc/securetty as a match for tty '5'
  (which is what other pieces of the system think it is). Fixes bug #7641.- argh, turn off gratuitous debugging- update to 0.72
- fix pam_unix password-changing bug
- fix pam_unix's cracklib support
- change package URL- don't allow '/' on service_name- enhance the pam_userdb module some more- add documenatation- a tiny change to pam_console to make it not loose track of console users- a few fixes to pam_xauth to make it more robust- pam_console: added <xconsole> to manage /dev/console- pam_xauth: New refcounting implementation based on idea from Stephen Tweedie- added video4linux devices to /etc/security/console.perms- added joystick lines to /etc/security/console.perms- fixed a couple segfaults in pam_xauth uncovered by yesterday's fix...- use gcc -shared to link the shared libs- many bug fixes in pam_xauth
- pam_console can now handle broken applications that do not set
  the PAM_TTY item.- fixed glob/regexp confusion in pam_console, added kbd and fixed fb devices
- added pam_xauth module- pam_lastlog does wtmp handling now- added option parsing to pam_console
- added framebuffer devices to default console.perms settings- fixed empty passwd handling in pam_pwdb- changed /dev/cdrom default user permissions back to 0600 in console.perms
  because some cdrom players open O_RDWR.- added /dev/jaz and /dev/zip to console.perms- changed the default user permik@ shouldn't fail on broken configs unless
  policy is set to enforcing (Dan Walsh)- update pam audit patch
- add support for new limits in kernel-2.6.12 (#157050)- add the Requires dependency on audit-libs (#159885)
- pam_loginuid shouldn't report error when /proc/self/loginuid
  is missing (#159974)- update the pam audit patch to support newest audit library,
  audit also pam_setcred calls (Steve Grubb)
- don't use the audit_fd as global static variable
- don't unset the XAUTHORITY when target user is root- pam_console: support loading .perms files in the console.perms.d (#156069)- pam_xauth: unset the XAUTHORITY variable on error, fix
  potential memory leaks
- modify path to IDE floppy devices in console.perms (#155560)- Adjusted pam audit patch to make exception for ECONNREFUSED- added auditing patch by Steve Grubb
- added cleanup patches for bugs found by Steve Grubb
- don't clear the shadow option of pam_unix if nis option used- #150537 - flush input first then write the prompt- make pam_unix LSB 2.0 compliant even when SELinux enabled
- #88127 - change both local and NIS passwords to keep them in sync,
  also fix a regression in passwd functionality on NIS master server- #153711 fix wrong logging in pam_selinux when restoring tty label- fix NULL deref in pam_tally when it's used in account phase- upgrade to the new upstream release
- moved pam_loginuid to pam-redhat repository- fix wrong logging in pam_console handlers
- add executing ainit handler for alsa sound dmix
- #147879, #112777 - change permissions for dri devices- remove ownership and permissions handling from pam_console call
  pam_console_apply as a handler instead- add pam_loginuid module for setting the the login uid for auditing purposes
  (by Steve Grubb)- add functionality for running handler executables from pam_console
  when console lock was obtained/lost
- removed patches merged to pam-redhat- echo why tests failed when rebuilding
- fixed some warnings and errors in pam_console for gcc4 build
- improved parsing pam_console config file- don't log garbage in pam_console_apply (#147879)- don't require exact db4 version only conflict with incompatible one- updated pam-redhat from elvis CVS
- removed obsolete patches- depend on db-4.3.27, not db-4.3.21.- add argument to pam_console_apply to restrict its work to specified files- update to Linux-PAM-0.78
- #140451 parse passwd entries correctly and test for failure
- #137802 allow using pam_console for authentication- rebuild against db-4.3.21.- #77646 log failures when renaming the files when changing password
- Log failure on missing /etc/security/opasswd when remember option is present- #87628 pam_timestamp remembers authorization after logout
- #116956 fixed memory leaks in pam_stack- #74062 modify the pwd-lock patch to remove NIS passwd changing deadlock- #134941 pam_console should check X11 socket only on login- Fix checking of group Development/Debug syntax in pam_limits
- Drop fencepost patch as it was already fixed 
  by upstream change from 0.75 to 0.77
- Fix brokenshadow patch- Added bluetooth, raw1394 and flash to console.perms
- pam_console manpage fix- #129328 pam_env shouldn't abort on missing /etc/environment
- #126985 pam_stack should always copy the conversation function 
- #127524 add /etc/security/opasswd to files- Drop last patch again, fixed now correctly elsewhere- Fixed bug in pam_env where wrong initializer was used- rebuild selinux patch using checkPasswdAccess- rebuilt- #75454 fixed locking when changing password
- #127054 
- #125653 removed unnecessary getgrouplist call
- #124979 added quiet option to pam_succeed_if- #126024 /dev/pmu console perms- Move pam_console.lock to /var/run/console/- Close fd[1] before pam_modutilread so that unix_verify will complete- First chunk of Steve Grubb's resource leak and other fixes- Fixed build testing of modules
- Fixed dependancies- Change unix_chkpwd to return pam error codes- Fixed the pam glib2 dependancy issue- Fixed the pam_limits fencepost error (#79989) since Bj0jd@dec) [847613]
- [net] reduce per cpu ram used for loopback stats (Weiping Pan) [872466]
- [net] ipv4: check optlen for IP_MULTICAST_IF option (Jiri Pirko) [866743]- [fs] ext4: prevent race while walking extent tree for fiemap (Lukas Czerner) [692071]
- [fs] ext4: Fix possibly very long loop in fiemap (Lukas Czerner) [692071]
- [fs] ext4: make FIEMAP and delayed allocation play well together (Lukas Czerner) [692071]
- [fs] ext4: handle NULL p_ext in ext4_ext_next_allocated_block() (Lukas Czerner) [692071]
- [fs] ext4: drop ec_type from the ext4_ext_cache structure (Lukas Czerner) [692071]
- [fs] afs: export a couple of core functions for AFS write support (Lukas Czerner) [692071]
- [fs] cifs: show sec= option in /proc/mounts (Sachin Prabhu) [806481]
- [fs] cifs: Introduce workaround for crypto module loading problem (Sachin Prabhu) [806481]
- [fs] cifs: Fix extended security auth failure (Sachin Prabhu) [806481]
- [fs] cifs: silence printk when establishing first sess on socket (Sachin Prabhu) [806481]
- [fs] cifs: Fix sign failure when serv mandates sign for NTLMSSP (Sachin Prabhu) [806481]
- [fs] cifs: Support NTLM2 sess security dur NTLMSSP authenticate (Sachin Prabhu) [806481]
- [fs] cifs: ignore everything in SPNEGO blob after mechTypes (Sachin Prabhu) [806481]
- [fs] cifs: check offset in decode_ntlmssp_challenge() (Sachin Prabhu) [806481]
- [fs] cifs: endian fix in decode_ntlmssp_challenge (Sachin Prabhu) [806481]
- [fs] cifs: NTLM auth/sign - create & send keys for key exchange (Sachin Prabhu) [806481]
- [fs] cifs: mv 'ntlmssp' & 'local_leases' opts from experimental (Sachin Prabhu) [806481]
- [fs] cifs: Remove distinction between rawntlmssp and ntlmssp. (Sachin Prabhu) [806481]
- [fs] cifs: Fix broken sec=ntlmv2/i sec option (try #2) (Sachin Prabhu) [806481]
- [fs] cifs: NTLM auth/sign - minor error corrections and cleanup (Sachin Prabhu) [806481]
- [fs] cifs: NTLM auth/sign - Alloc sess key/client res dynamically (Sachin Prabhu) [806481]
- [fs] cifs: NTLM authent & signing - Calc auth response per sess (Sachin Prabhu) [806481]
- [fs] cifs: ntlm authent & signing - proper av/ti pair for ntlmv2 (Sachin Prabhu) [806481]
- [fs] cifs: fix module refcount leak in find_domain_name (Sachin Prabhu) [806481]
- [fs] cifs: ntlm authent & signing - Fix response len for ntlmv2 (Sachin Prabhu) [806481]
- [fs] cifs: NTLMv2/NTLMSSP ntlmv2 within ntlmssp authenticate code (Sachin Prabhu) [806481]
- [fs] cifs: NTLMv2/NTLMSSP Change var name mac_key to session key (Sachin Prabhu) [806481]
- [fs] cifs: ntlmv2/ntlmssp rem function CalcNTLMv2_partial_mac_key (Sachin Prabhu) [806481]
- [fs] cifs: have decode_negTokenInit set flags in server struct (Sachin Prabhu) [806481]
- [fs] cifs: eliminate 'first_time' parm to CIFS_SessSetup (Sachin Prabhu) [806481]
- [fs] cifs: Allow raw ntlmssp code to be enabled with sec=ntlmssp (Sachin Prabhu) [806481]
- [fs] cifs: Fix SMB uid in NTLMSSP authenticate request (Sachin Prabhu) [806481]
- [fs] cifs: NTLMSSP reenabled after move from connect.c to sess.c (Sachin Prabhu) [806481]
- [fs] cifs: Add remaining ntlmssp flags & standardize field names (Sachin Prabhu) [806481]
- [misc] genalloc: stop crashing the system when destroying a pool (Steve Best) [859194]
- [x86] mm: introduce proper mem barriers smp_invalidate_interrupt (Rafael Aquini) [865095]
- [x86] Add sysctl to allow panic on IOCK NMI error (Prarit Bhargava) [918279]- [fs] nfs: flush cached dir information slightly more readily (Scott Mayhew) [853145]
- [fs] nfs: Fix resolution prob with cache_change_attribute (Scott Mayhew) [853145]
- [fs] nfs: define function to update nfsi->cache_change_attribute (Scott Mayhew) [853145]
- [fs] nfsv4: Save the owner/group name string when doing open (Scott Mayhew) [609252]
- [fs] nfsv4: Don't do idmapper upcalls for asynchronous RPC calls (Scott Mayhew) [609252]
- [fs] nfsv4: Fix cache validate bug where getcwd() returns ENOENT (Scott Mayhew) [609252]
- [fs] nfsv4: Simplify some cache consistency post-op GETATTRs (Scott Mayhew) [609252]
- [fs] nfsv4: set fattr->valid to reflect whatj@HW@WXV0430]
- [net] cnic: Add FCoE support on 57712 (Mike Christie) [660430]
- [net] cnic: Add kcq2 support on 57712 (Mike Christie) [660430]
- [net] cnic: Call cm_connect_complete() immediately on error (Mike Christie) [660430]
- [net] cnic: Check device state before reading the kcq pointer in IRQ (Mike Christie) [660430]
- [net] cnic: Support NIC Partition mode (Mike Christie) [660430]
- [net] cnic: Use proper client and connection IDs on iSCSI ring (Mike Christie) [660430]
- [net] cnic: Improve ->iscsi_nl_msg_send() (Mike Christie) [660430]
- [net] cnic: Prevent "scheduling while atomic" when calling ->cnic_init() (Mike Christie) [660430]
- [net] cnic: Fix iSCSI TCP port endian order. (Mike Christie) [660430]
- [net] cnic: Remove unnecessary semicolons (Mike Christie) [660430]
- [net] cnic: Add support for 57712 device (Mike Christie) [660430]
- [net] cnic: Decouple uio close from cnic shutdown (Mike Christie) [660430]
- [net] cnic: Add cnic_uio_dev struct (Mike Christie) [660430]
- [net] cnic: Add cnic_free_uio() (Mike Christie) [660430]
- [net] cnic: Defer iscsi connection cleanup (Mike Christie) [660430]
- [net] cnic: Add cnic_bnx2x_destroy_ramrod() (Mike Christie) [660430]
- [net] cnic: Convert ctx_flags to bit fields (Mike Christie) [660430]
- [net] cnic: Add common cnic_request_irq() (Mike Christie) [660430]
- [net] bnx2x, cnic: Fix SPQ return credit (Mike Christie) [660430]
- [char] Enable and extend Legacy PTY support for 4096 device pairs (Mauro Carvalho Chehab) [582776]
- [fs] ioctl: make fiemap map at least a blocksize amount (Josef Bacik) [663041]
- [net] forcedeth/r8169: call netif_carrier_off at end of probe (Ivan Vecera) [664705 664707]
- [net] ixgbevf: update to upstream version 2.0.0-k2 (Andy Gospodarek) [653237]
- [net] e1000e: update to upstream version 1.3.10 (Andy Gospodarek) [653242 653548]
- [x86] amd: Extend support to future families (Frank Arnold) [682835]
- [x86] smpboot: Use compute unit info to determine thread siblings (Frank Arnold) [682835]
- [x86] amd: Extract compute unit information for AMD CPUs (Frank Arnold) [682835]
- [x86] amd: Add support for CPUID topology extension of AMD CPUs (Frank Arnold) [682835]
- [x86] cpufeature: Update AMD CPUID feature bits (Frank Arnold) [682835]
- [x86_64] Support NMI watchdog on newer AMD CPU families (Frank Arnold) [682835]
- [net] ixgbe: fix for 82599 erratum on Header Splitting (Andy Gospodarek) [680531]
- [net] ixgbe: limit VF access to network traffic (Andy Gospodarek) [680531]
- [net] igbvf driver update for RHEL5.7 (Stefan Assmann) [653241]
- [fs] ext3: Always set dx_node's fake_dirent explicitly (Eric Sandeen) [662838]
- [virt] xen/netback: signal front-end close event via udev (Paolo Bonzini) [661985]
- [net] bnx2x: fix swap of rx-ticks and tx-ticks parameters in interrupt coalescing flow (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: fix MaxBW configuration (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: (NPAR) prevent HW access in D3 state (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: fix link notification (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: fix non-pmf device load flow (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: update driver version to 1.62.00-6 (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: properly calculate lro_mss (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: perform statistics "action" before state transition. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: properly configure coefficients for MinBW algorithm (NPAR mode). (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix ethtool -t link test for MF (non-pmf) devices. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Fix nvram test for single port devices. (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: (NPAR mode) Fix FW initialization (Michal Schmidt) [629609 651546 653357 656360]
- [net] bnx2x: Add a missing bit for PXP parity register of 57712. (Michal Schmidt) [629609 651546 653357 656zke t	@t	u	
S 
- forward port VGA16 patch from Paulo César Pereira de 
  Andrade <pcpa@conectiva.com.br>
- add patch for cciss, ida, and rd raid controllers
- don't pass mem= to the kernel- initial build for Red Hat/bin/sh/bin/shbuilder10.centos.org 1385734693,-1./023+0.97-13.11.el5_10.1	



grubgrubgrub-installgrub-md5-cryptgrub-terminfombchkgrub-0.97AUTHORSCOPYINGChangeLogNEWSREADMETODOmenu.lstgrubx86_64-redhate2fs_stage1_5fat_stage1_5ffs_stage1_5iso9660_stage1_5jfs_stage1_5minix_stage1_5reiserfs_stage1_5stage1stage2stage2_eltoritoufs2_stage1_5vstafs_stage1_5xfs_stage1_5grub.info.gzmultiboot.info.gzmbchk.1.gzgrub-install.8.gzgrub-md5-crypt.8.gzgrub-terminfo.8.gzgrub.8.gz/boot//sbin//usr/bin//usr/share/doc//usr/share/doc/grub-0.97//usr/share//usr/share/grub//usr/share/grub/x86_64-redhat//usr/share/info//usr/share/man/man1//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII English textBourne shell script text executableELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), for GNU/Linux 2.6.9, statically linked, strippeddirectoryRRR? 
]NVi7}eRܼX?RGV(5j#]:;qp"5x
0˞?Y[:Y#?RGV(s1<E%njRйawsB486cd971074f7888265f8d8448e6a8fbd3f6f2ee8\<T\<register on x86_64 with
  -mcmodel=kernel -fstack-protector (Arjan van de Ven, #202842)
- don't create jar manifest in libgcj-tools-4.*.jar (#200887)
- externally_visible attribute fixes (Jan Hubicka, PRs c/25795, c++/27369)
- --combine fixes for aggregates with attributes (PRs c/28706, c/28712)
- further externally_visible attr fixes (PR c/28744)
- fix invalid token pasting error message (PR preprocessor/28709)
- obey OpenMP 2.5 chapter 4 env var requirements (whitespace rules
  and case insensitivity in the env vars; PR libgomp/28725)
- fix OPT_FLAGS on sparc- fix multilib conflict in libgcj-tools-4.1.1.jar (#200887)- update from gcc-4_1-branch (-r115877:116082)
  - PRs c++/27508, c++/28148, c++/28250, c++/28256, c++/28257, c++/28259,
	c++/28267, c++/28274, c++/28347, c++/28432, c++/28557, c++/28594,
	c++/28637, c++/28638, c++/28639, c++/28640, c++/28641, c/27721,
	c/28136, fortran/27981, fortran/28548, fortran/28590,
	middle-end/28651, rtl-optimization/27291, rtl-optimization/28221,
	target/27566, target/27827
- fix Fortran ICE with nested function (Paul Thomas, #200618,
  PR fortran/28600)- update from gcc-4_1-branch (-r115644:115877)
  - PRs c++/27572, c++/27668, c++/27962, c++/28025, c++/28258, c++/28523,
	debug/25468, fortran/20892, fortran/27874, fortran/28129,
	fortran/28439, libgfortran/28335, libgfortran/28339,
	middle-end/28402, middle-end/28403, middle-end/28473,
	target/27287, target/28247, tree-optimization/26719,
	tree-optimization/27639, tree-optk`2-@2-1-3-a, version 89a, 756 x 353GIF image data, version 89a, 90 x 34HTML document textPNG image data, 12 x 12, 8-bit grayscale, non-interlacedPNG image data, 128 x 128, 8-bit/color RGB, non-interlacedPNG image data, 15 x 9, 4-bit colormap, non-interlacedPNG image data, 15 x 9, 8-bit grayscale, non-interlacedPNG image data, 24 x 24, 8-bit colormap, non-interlacedPNG image data, 24 x 24, 8-bit grayscale, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 25 x 24, 8-bit grayscale, non-interlacedPNG image data, 35 x 15, 8-bit colormap, non-interlacedPNG image data, 652 x 694, 8-bit/color RGB, non-interlacedPNG image data, 72 x 48, 8-bit/color RGB, non-interlacedXML document texta /usr/bin/python -u script text executablecurrent ar archivedirectoryexported SGML document textsymbolic link to `libxml2.so.2.6.26'RRR?P";8e>j?TnXҨGV([M=a26wOhV
a7#o9?TnXҨGV(RHIbȅiQJ,`jjBq@ve unwinder patches from x86/x86_64 (Don Zickus ) [220238]
- usb: disable ub and libusual (Pete Zaitcev ) [210026]
- NetLabel: stricter configuration checking (Eric Paris ) [219393]
- scsi: fix iscsi sense len handling (Mike Christie ) [217933]
- Xen: emulate PIT channels for vbios support (Stephen C. Tweedie ) [215647]
- VM: Fix nasty and subtle race in shared mmap'ed page writeback (Eric Sandeen ) [220963]
- Audit: Add type for 3rd party, emit key for audit events (Eric Paris ) [217958]
- NFS: system stall on NFS stress under high memory  pressure (Steve Dickson ) [213137]
- netfilter: IPv6/IP6Tables Vulnerabilities (Thomas Graf ) [220483]
- acpi: increase ACPI_MAX_REFERENCE_COUNT (Doug Chapman ) [217741]
- Race condition in mincore can cause ps -ef to hang (Doug Chapman ) [220480]
- Call init_timer() for ISDN PPP CCP reset state timer (Marcel Holtmann ) [220163]
- Race condition concerning VLAPIC interrupts (Bhavana Nagendra ) [213858]- CIFS: Explicitly set stat->blksize (Steve Dickson ) [210608]
- FS-Cache: dueling read/write processes fix (Steve Dickson ) [212831]
- xen: Use swiotlb mask for coherent mappings too (Herbert Xu ) [216472]
- ia64: Kexec, Kdump on SGI IA64 NUMA machines fixes (George Beshers ) [219091]
- splice : Must fully check for fifos (Don Zickus ) [214289]
- Xen: Fix potential grant entry leaks on error (Herbert Xu ) [217993]
- e1000: truncated TSO TCP header with 82544, workaround (Herbert Xu ) [206540]
- scsi: fix bus reset in qla1280 driver (George Beshers ) [219819]
- scsi: add qla4032 and fix some bugs (Mike Christie ) [213807]
- XFRM: Config Change Auditing (Eric Paris ) [209520]
- Xen: ia64 guest networking finally works (Jarod Wilson ) [218895]
- scsi structs for future known features and fixes (Mike Christie ) [220458]
- squashfs fixup (Steve Grubb ) [219534]
- ppc64: DLPAR virtual CPU removal failure - cppr bits (Janice M. Girouard ) [218058]
- ia64: allow HP ZX1 systems to initalize swiotlb in kdump (Neil Horman ) [220064]
- export tasklist_lock (David Howells ) [207992]
- gfs2: Initialization of security/acls (Steven Whitehouse ) [206126]
- x86: handle _PSS object range corectly in speedstep-centrino (Brian Maly ) [211690]
- GFS2 change nlink panic (Wendy Cheng ) [215088]
- scsi: fix oops in iscsi packet transfer path (Mike Christie ) [215381]
- Fix Emulex lpfc ioctl on PPC (Tom Coughlan ) [219194]
- Xen: Fix agp on x86_64 under Xen (Stephen C. Tweedie ) [217715]
- Emulex lpfc update to 8.1.10.2 (Tom Coughlan ) [218243]
- bluetooth: Add packet size checks for CAPI messages (Marcel Holtmann ) [219139]
- x86_64: create Calgary boot knob (Konrad Rzeszutek ) [220078]
- cciss bugfixes (Tom Coughlan ) [185021]
- ia64: Do not call SN_SAL_SET_CPU_NUMBER twice on cpu 0 on booting (Erik Jacobson ) [219722]
- scsi: Empty /sys/class/scsi_host/hostX/config  file (Janice M. Girouard ) [210239]
- refresh: Reduce iommu page size to 4K on 64K page PPC systems (Janice M. Girouard) [212097]
- update: Xen netback: Reenable TX queueing and drop pkts after timeout (Herbert Xu ) [216441]- xen: Update xen paravirt framebuffer to upstream protocol (fixes) (Stephen C. Tweedie ) [218048]
- xen: Update xen paravirt framebuffer to upstream protocol (Stephen C. Tweedie ) [218048]
- nfs: disable Solaris NFS_ACL version 2  (Steve Dickson ) [215073]
- xen: EXPORT_SYMBOL(zap_page_range) needs to be moved (Stephen C. Tweedie ) [218476]
- ppc64: disable unused drivers that cause oops on insmod/rmmod (Janice M. Girouard ) [206658]
- scsi: GoVault not accessible due to software reset. (Konrad Rzeszutek ) [215567]
- GFS2 fix DIO deadlock (Steven Whitehouse ) [212627]
- dlm: fix lost flags in stub replies (David Teigland ) [218525]
- CacheFiles: Improve/Fix reference counting (David Howells ) [212844]
- gfs2: Fails back to readpage() for stuffed files (Steven Whitehouse ) [218966]
- gfs2: Use try locks in readpages (Steven Whitehouse ) [218966]
- GFS2 Readpages fix (part 2) (Steven Whitehouse ) [218966]
- gfs2: Readpages fix  (Steven Whitehouse ) [218966]
- bonding: Don't release slaves when masterkm+@++fRRRRRRR	R
RRRRPRRRR
RRR?@hg!ì3j5?Q/<GV(.ft%m'cp߿Дa
N?Q/<GV(VHiUV[8m!$cN>=	
^R򆂌a5095e3d092c6e0436362688c0e16af4564e21a3\=qt\<qbY?6'zgVD3%veTIFFReadEncodedTile.3tiff.gz\named-checkzoneZperformanceE	N	nsIDOMSVGUnitTypes.idlE	N	nsIDOMSVGStyleElement.idlEN$nsStyleUtil.hENnsSAXAttributes.hENnsITypeAheadFind.hENnsIEnumerator.hE
NnsIElementObserver.hENnsIDOMXULControlElement.hENnsIDOMHTMLOListElement.hEbNnnsIDNSRecord.hB\TokenRingHardwareDruid.py?bonobo-browserfunction::task_parent.3stap.gz{libebl_s390.so
:10x20-ISO8859-15.pcf.gz	l2cap.ko	sn9c102.ko-S		YT.extrand2i_Netscape_RSA.3ssl.gziLLdraft-ietf-cat-kerb-chg-password-02.txtYZtest_cmath.pyc
02,cvs.5.gz,,check-button.pngGtkExpander.htmlRRgtkcheckmenuitem.hYZkernel_kernel.htmlreader4.cEEAPIchunk20.htmlZkoi8-u_to_uni.transZ8859-9.a0-ff.16.gzYPortability.htmlYWchap7-net-Ar.png(Mmac_latin2.pyc(
iso8859_10.py(*StringIO.pyPftpd-xferlog.confldap_modrdn2.3.gzhtmltidy.c:re15.html	[pata_sis.koYserviceconf.gladefzfherehistory-pattern-searchY.lex.o.cmd`Yaposix_acl_xattr.hYip_conntrack_sip.h~Y|rhine.hYplugins.hY4040.h
Y
amd8111e
Y
8139cp.hYrioni2d_X509_NAME.3ssl.gznooRSA_generate_key.3ssl.gznBIO_retry_type.3ssl.gz/mdir.1.gzx!016.pngstock-export.png[#file-video-mov.png(package_utilities.pngu B sb_right_arrow+alsa-lib-devel-1.0.1744fc-list5vfork.3p.gz5?	isspace.3p.gz5qfclose.3p.gz5,sem_close.3.gz.^^lock.html&vid_puts.3x.gz ZZposix_time_zone.hppfeatures.htmlfunc_8h-sou:	K:	:	I:	hh%i(~B;ٿL}`~`DS06)w~|
RZ_}~#5/,}~v.-sS&||<`KgiʱEsVsWQOʃqXv}rr[ezӹMp6>GŰ9m8yGՋٺ젷sUɂ],>IckM竀..v'`%EueKKKEKuKKeKEueIIIEIuIIeI{4VOQRKI<1T
|A_5	̵`vv
U'/07u/epR%m3oBn<'=PLt=
֑	Ә\Ja8D.~Mm
58],Gr$5kpvF@FGH8\<
							ASCII C program textASCII textGIF image data, version 89a, 1 x 1GIF image data, version 89a, 400 x 300GIF image data, version 89a, 9 x 300HTML document textPNG image data, 100 x 45, 8-bit colormap, non-interlacedXML document textdirectorysymbolic link to `libdbus-1.so.3.4.0'
k7P@fd3211ba829e41f452cc983d6b3cbd9229407cfdcfd21d1f6c95e6494637d28e6946e89098ba7338a450e0e3428ecfafb54a1dd492a5045241b78d6a60348e2b01c7e9fa2846947e2b749a2d14d500ad010b60bfddadb72f8c0786eb62b4bedc778374564663a4120f5dcb5335a522adf7e28c29aee5f86adf2d2d7a8ecdd30d563ac6b6c81f4a75d85ac5ca681d68efdd14df78eece406873239d0ce0a8b3d3fd3211ba829e41f452cc983d6b3cbd9229407cfdcfd21d1f6c95e6494637d28e6946e89098ba7338a450e0e3428ecfafb54a1dd492a5045241b78d6a60348e2b01c7e9f9a3f95fafa94f5534e9a4e7678847323dbf50d87c0e76434c7a7bccef8d58d2ab4a20aad1def360991d816efbaced088d726cea88597a003d9948ede3a57911c52b604e41a5f6c17d43dff0548827bd8d18c3c8c5fc29ae55fede7f5baaa9df49d34011cc540bc3d9e2f4e95fc8898dd7fbf9c3a7f8405ff4d34ebb54b229374b22d7fde409f8a5acad75293ad0e82601b5383672682199d3d57c6caed9ae33eb6c8ecbdfd6afde101d8af3a52b4bb2e9a8e40d30455f88903e347694bfd5d5db4a20aad1def360991d816efbaced088d726cea88597a003d9948ede3a57911c52b604e41a5f6c17d43dff0548827bd8d18c3c8c5fc29ae55fede7f5baaa9df49d34011cc540bc3d9e2f4e95fc8898ddb33393bee16ddb997a7165f54f94a22c82512d911f63460469d3cd69642b71394f9b42ff310bc160e3de9356667f598ccb59df44c07045e3aec6850f2ac367189cd7e79634062cbb70ad7eece9a3e3f82273735ab6f2faf8246958bda46593038afdf0d1eb5cbf4a156f56349815ad34dcfb68fa1cabc4077782b43da32950d6cbe3bf034adb740f00b503d3d2c58a4f833157ec857185de8dcfe18df7618db62d99f4ef102e29e6cd36a19975d4968eed57d23f55e96d1177fbdc91751edf3c5855d36609f6fb343238851ecfabd25e4642749e342553dddf26f8dccf85f563dee6776a5e2a993f7b7bad1e28ea5db12b939814050b10dab16f7d2c9af2c13021e9d1783542e9ab6067807dfe5136f35dc2a38655e51891dfb53ab6071d202ed8d481fbc20416a78d6e08150fea14e21f1968eab49f4a4639b319c82479506b3038d5b696be03eec87ec9bf51fdd452b5ea9bb8fb0c8e059471befa7d2d65f038600909dbb26d205d3122a8c1873f5b193ed9cf4dc61cb4f0740bc15e9fe914ace026c191e80d6c9f45485d7811e302abd759f03155fa681935e6169998155e764a02bc56f9e20098dddd23f265dfec8529d07656cd58d742167f89b59fac97b05fca8eecaa32c49d36267724a933d22396bc67847d756b34516960e2694e372e4f90bff74b3e535992408ed5b68c1c9a59a8441cd811c5427744bb8eb8bb6d02579b8f8f080ecaf47d70b1e30a1b0538357c359b7584b01267fc13e66681fe0089b53934491c01793241ae56309201ea79bd0f9bd623e0edaed61f8512e58180ea65e145f57818b0f0e6189a5d5e3138625c8b3471bffe840f9bde91973df9b6e848ec035061110cd2d65a7cbcf794cb1ceb2a5748a4288cfb9f7168f60cd5c9cb82edb0053e4403b1ee8cb6c24d7b8ab649e17c89d6f1f976771b694333711d0c1e34bb5ba239597c75b900bd7756586ab55fc613f3ede3e03f3dc5622c0ad2c78fc0499e4a89a7eee48ae54b1d0b201df6afa076c9ba6276683bf77211c80fa61e5a87822fb3a516cfe9d5208f283edf6d4f824e5d388981a391a58778a8269e7ad67496f082a8d5fb36ba833d08ba5a9ea6aaf7c9ba29af00c81c53f6ef980d4838b5b27cb08b128120a1437d9064c4145790c6e8463ad24084d2ad6e84a7df46649af7956811b4a092839e9a58e86678597d808f39a622423c384958ac5604e9b96fa423b24c836739d76d4b53f72b6d6f5956e6025013d1e4621bd851b9cab3440053d35c4237c393ff21e5fb80f095e0e6d8fb18f7157818465065fcbc731d8b434b06fecb4c73127725805584acf822d0f35059724e8d3160a994560323e102fffc67a3cd0a84d82e6267ac961f189a6fb803ea0e47a29fd908961c5cc1e7ee30041a9e717418003e7024822ef1d76541de283f5c245ff6be5e512972501d7cb955a7ea8f1fab7e6415318333d67e15bd015e86a9280a71a2ba3c37e8859cb6a4ecaa008b53270a2d5f9606685dcf5c740c5beec49ef976d9d15d1745d003f5b26f601566a925f08deb49acd0e1424abb2e3f17707618a499c2999803802b2c99db9eeca07e25c1c89b7e446eaccce95c588a828377e6220717a1f9d44126af80c1fa6c40d01ba929007752d46d7accf6570f7e5ac2a5709b6f79cf09280649431a3f84b4669c7a1a3b3cede0c5e8699b8d9797c11f4f37e15bac716c33375c9e46e197c62b92429f6e3ef6139cbe90bc1b3e4fae9e01837d8d77b933abfd99d9103cb743f263030f7bce2df4c343c7fe0dc9787e1383808b15a28ddeb21b638c92ae9af73d495ba8ebdb24da76304165b23eb1b8a13954e9fa1258e949d0f59812e554da79ff44908aa9fb1dfdbc2d1982cd00535baa57abd7f24c9c52de7e056f58627d3a767c5a144ef0edf42ad2a7c3f6419fe94569cac8009f218682466d609bac2df2b5c482bbf81a8bb85fc62069d2ee0ab634b6ce0ec78ad88c08a14bc9dfcc02924a3eb4f15b1657e0cb2068d4eccfe359ea31f9f30590ef18f7642b06e9k Y@dd another set of fixes for 429024, turned out this was not
  completely fixed as expected
- Add some other patches from Guenther to join Windows 2008 (Rc1)
  domain controllers
- Make sure bad port numbers are reported and smbd exits if it
  can't bind to any port (completes fix for #429003)
- Fix a regression in ACLs code that was causing samba to set the
  wrong inherited permissions
- resolves: #429024
- related: #291501
- resolves: #429003
- resolves: #431243- Add 2 more patches to fix a Samba DC talking to trusted
  domains.
- resolves: #429024
- related: #291501- resolves: #429003
- related: #291501- Add more fixes on top 3.0.28 as committed upstream
- Fixes typo and removes trailing spaces in default smb.conf file
- resolves: #426244
- related: #291501
- resolves: #426623
- resolves: #383351
- resolves: #425996- rebase to 3.0.28 (3.0.x is in bugfix/security fix only mode
  since 3.2.x was announced) + later Vista fixes
- resolves: #291501
- resolves: #370501- Security fix for CVE-2007-6015
- Fix for regression introduced with CVE-2007-4572
- resolves: CVE-2007-6015
- resolves: CVE-2007-4572- Security fix for CVE-2007-4138
- Security fix for CVE-2007-4572
- Security fix for CVE-2007-5398
- Multilib Fix
- resolves: #351511
- resolves: #350771
- resolves: #359161
- resolves: #338141- resolves: #247538
- resolves: #247539- update to 3.0.25b
- resolves: #244820- Upgrade to 3.0.25a- Fix non security related bug in the patch for CVE-2007-2447- Security fixes for
  CVE-2007-2446
  CVE-2007-2447- Rebuild into correct tag.
  Resolves: rhbz#225519 CVE-2007-0452 Samba smbd denial of service- Include backported patch
  Resolves: rhbz#225519 CVE-2007-0452 Samba smbd denial of service- New upstream release.- New upstream release.- Fix the -logfiles patch to close
  bz#199607 Samba compiled with wrong log path.
  bz#199206 smb.conf has incorrect log file path- Upgrade to new upstream 3.0.23a
- include upstream samr_alias patch- New upstream release.
- Use modified filter-requires-samba.sh from packaging/RHEL/setup/
  to get rid of bogus dependency on perl(Unicode::MapUTF8)
- Update the -logfiles and -smb.conf patches to work with 3.0.23- New upstream RC release.
- Update the -logfiles, and -passwd patches for
  3.0.23rc3
- Include the change to smb.init from Bastien Nocera <bnocera@redhat.com>)
  to close
  bz#182560 Wrong retval for initscript when smbd is dead
- Update this spec file to build with 3.0.23rc3
- Remove the -install.mount.smbfs patch, since we don't install
  mount.smbfs any more.- rebuilt with new gnutls- New upstream version.- New upstream version.
- Since the rawhide kernel has dropped support for smbfs, remove smbmount
  and smbumount.  Users should use mount.cifs instead.
- Upgrade to 3.0.21b- bump again for double-long bug on ppc(64)- rebuilt- turn on -DLDAP_DEPRECATED to allow access to ldap functions that have
  been depricated in 2.3.11, but which don't have well-documented
  replacements (ldap_simple_bind_s(), for example).
- Upgrade to 3.0.20b, which includes all the previous upstream patches.
- Updated the -warnings patch for 3.0.20a.
- Include  --with-shared-modules=idmap_ad,idmap_rid to close
  bz#156810 --with-shared-modules=idmap_ad,idmap_rid
- Include the new samba.pamd from Tomas Mraz (tmraz@redhat.com) to close
  bz#170259 pam_stack is deprecated- epochs from deps, req exact release
- rebuild against new openssl- New upstream release
  Includes five upstream patches -bug3010_v1, -groupname_enumeration_v3,
    -regcreatekey_winxp_v1, -usrmgr_groups_v1, and -winbindd_v1
  This obsoletes the -pie and -delim patches
  the -warning and -gcc4 patches are obsolete too
  The -man, -passwd, and -smbspool patches were updated to match 3.0.20pre1
  Also, the -quoting patch was implemented differently upstream
  There is now a umount.cifs executable and manpage
  We run autogen.sh as part of the build phase
  The testprns command is now gone
  libsmbclient now has a man page
- Include -bug106483 patch to close
  bz#106483 smbclient: -N negates the provide
k00@A큤A큤A큤A큤A큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AA큤AAA큤A큤AAA큤A큤A큤A큤큤A큤A큤A큤A큤A큤A큤A큤A큤큤큤큤A큤k@LF?Ed		F	 (<	F
Pd
*L`|


()*+,-8~9~:M~>B@BDBFBGCHC(IC<XCDYCL\C`]Ct^CbCdDeDfDkDlDtDuDvDwEtxEyE	{EEEEAF-A
FnFFFgFhFCfreetype2.2.132.el5_9.1A free and portable font rendering engineThe FreeType engine is a free and portable font rendering
engine, developed to provide advanced font support for a variety of
platforms and environments. FreeType is a library which can open and
manages font files as well as efficiently load, hint and render
individual glyphs. FreeType is not a font server or a complete
text-rendering library.Q
̬builder10.centos.org	qCentOS-5CentOSBSD/GPL dual licenseSystem Environment/Librarieshttp://www.freetype.orglinuxi3868A큤Q
̕Q
̗Q
̗DdDcQ1c69793515fcd76288db9e5e21c1b84125ac80fbd36c72ebe5ebe244b207ab57e89278a706af6b545631973425433cdelibfreetype.so.6.3.10rootrootrootrootrootrootrootrootrootrootfreetype-2.2.1-32.el5_9.1.src.rpmlibfreetype.so.6freetype@@@@@@@@@JJ@/bin/sh/sbin/ldconfig/sbin/ldconfiglibc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libfreetype.so.6rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)3.0.4-14.0-14.4.2.3{
  # ttmkfdir updated - as of 2.0.5-3, on upgrades we need xfs to regenerate
  # things to get the iso10646-1 encoding listed.
  for I in /usr/share/fonts/*/TrueType /usr/share/X11/fonts/TTF; do
      [ -d $I ] && [ -f $I/fonts.scale ] && [ -f $I/fonts.dir ] && touch $I/fonts.scale
  done
  exit 0
}freetype2.0.5-3QO{rNN`LL`LLYLH`L?L>3`L>3`I`HX3F\`Fq`Et`Ek_Egk`Egk`Egk`Egk`E`E`DDg`D8`DDߠD7`DpD`D`DkCC`C`C~NCg`CYdCM`CFCaBͥB(`A\`@q`@K@O@E@-H@`?p`?4`?>>`>`>k>H`>[`>L`>@7>/`>`>`==z=)`=4=`=mG=T;`===+\=*`=#s= ==r=!`<Z<}`<@<(<yb`<x<v`<\a`<[<E<<`<`;F`;;	;`;z;R`;J)`;6b;2n`;.y;&::j
`:h:^,:Jf`9l`9E]`8o`8@`88|`8{8)7~`6`6k6w`6v`6Ș6u`6.`6.Y`6-Marek Kasik <mkasik@redhat.com> 2.2.1-32.el5_9.1Marek Kasik <mkasik@redhat.com> 2.2.1-32Marek Kasik <mkasik@redhat.com> 2.2.1-31Marek Kasik <mkasik@redhat.com> 2.2.1-30Marek Kasik <mkasik@redhat.com> 2.2.1-29Marek Kasik <mkasik@redhat.com> 2.2.1-28Marek Kasik <mkasik@redhat.com> 2.2.1-27Josh Bressers <bressers@redhat.com> 2.2.1-26Marek Kasik <mkasik@redhat.com> 2.2.1-25Marek Kasik <mkasik@redhat.com> 2.2.1-24Marek Kasik <mkasik@redhat.com> 2.2.1-23Marek Kasik <mkasik@redhat.com> 2.2.1-22Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-21Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-20Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-19Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-18Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-16Behdad Esfahbod <besfahbo@redhat.com> 2.2.1-15BehdjO)@made up error codes (David Milburn) [676423]
- [net] bluetooth: fix bnep buffer overflow (Don Howard) [681319] {CVE-2011-1079}
- [pci] intel-iommu: Fix get_domain_for_dev() error path (Alex Williamson) [688646]
- [pci] intel-iommu: Unlink domain from iommu (Alex Williamson) [688646]
- [redhat] spec: assorted cleanup and streamlining- [md] dm-mpath: avoid storing private suspended state (Mike Snitzer) [678670]
- [md] dm-mpath: reject messages when device is suspended (Mike Snitzer) [678670]
- [md] dm: export suspended state to targets (Mike Snitzer) [678670]
- [md] dm: rename dm_suspended to dm_suspended_md (Mike Snitzer) [678670]
- [md] dm: swap postsuspend call and setting suspended flag (Mike Snitzer) [678670]
- [md] dm-ioctl: retrieve status from inactive table (Mike Snitzer) [678670]
- [md] dm: rename dm_get_table to dm_get_live_table (Mike Snitzer) [678670]
- [md] dm-stripe: avoid div by 0 with invalid stripe count (Mike Snitzer) [678670]
- [md] dm-ioctl: forbid messages to devices being deleted (Mike Snitzer) [678670]
- [md] dm: add dm_deleting_md function (Mike Snitzer) [678670]
- [md] dm: dec_pending needs locking to save error value (Mike Snitzer) [678670]
- [md] dm-raid1: keep retrying alloc if mempool_alloc fails (Mike Snitzer) [678670]
- [md] dm-table: fix upgrade mode race (Mike Snitzer) [678670]
- [md] dm-io: respect BIO_MAX_PAGES limit (Mike Snitzer) [678670]
- [md] dm-ioctl: validate name length when renaming (Mike Snitzer) [678670]
- [md] dm-log: fix dm_io_client leak on error paths (Mike Snitzer) [678670]
- [md] dm: avoid destroying table in dm_any_congested (Mike Snitzer) [678670]
- [md] dm-raid1: fix leakage (Mike Snitzer) [678670]
- [md] dm-mpath: validate hw_handler argument count (Mike Snitzer) [678670]
- [md] dm-mpath: validate table argument count (Mike Snitzer) [678670]
- [md] dm-mpath: fix NULL deref when path parameter missing (Mike Snitzer) [673058]
- [md] dm-mpath: wait for pg_init completion on suspend (Mike Snitzer) [673058]
- [md] dm-mpath: hold io until all pg_inits completed (Mike Snitzer) [673058]
- [md] dm-mpath: skip activate_path for failed paths (Mike Snitzer) [673058]
- [md] dm-mpath: pass struct pgpath to pg init done (Mike Snitzer) [673058]
- [md] dm-mpath: prevent io from work queue while suspended (Mike Snitzer) [673058]
- [md] dm-mpath: add mutex to sync adding and flushing work (Mike Snitzer) [673058]
- [md] dm-mpath: flush workqueues before suspend completes (Mike Snitzer) [673058]
- [powerpc] numa: Fix kABI breakage in paca struct (Steve Best) [651167]
- [powerpc] Disable VPHN polling during a suspend operation (Steve Best) [651167]
- [powerpc] mm: Poll VPA for topo changes, update NUMA maps (Steve Best) [651167]
- [powerpc] Add VPHN firmware feature (Steve Best) [651167]
- [fs] jbd2: fix /proc/fs/jbd2/<dev> with external journal (Lukas Czerner) [652321]
- [fs] nfs: wait for COMMIT RPC complete before task put (Jeff Layton) [441730]
- [fs] nfs: ->flush and ->fsync should use FLUSH_SYNC (Jeff Layton) [441730]
- [net] sunrpc: fix race in __rpc_wait_for_completion_task (Jeff Layton) [441730]
- [fs] nfs: Ensure proper cleanup on rpc_run_task fail (Jeff Layton) [441730]
- [fs] nfs: clean up the unstable write code (Jeff Layton) [441730]
- [fs] nfs: Don't use ClearPageUptodate if writeback fails (Jeff Layton) [441730]
- [fs] nfs: Fix an unstable write data integrity race (Jeff Layton) [441730]
- [fs] nfs: make sure WRITE and COMMIT are uninterruptible (Jeff Layton) [441730]
- [fs] nfs: change how FLUSH_STABLE flag is used (Jeff Layton) [441730]
- [mm] writeback: fix queue handling in blk_congestion_wait (Jeff Layton) [516490]
- [fs] nfs: clean up nfs congestion control (Jeff Layton) [516490]
- [block] Add real API for dealing with blk_congestion_wait (Jeff Layton) [516490]
- [fs] nfs: kswapd must not block in nfs_release_page (Jeff Layton) [516490]
- [fs] nfs: Prevent another deadlock in nfs_release_page (Jeff Layton) [516490]
- [fs] nfs: Try commit unstable writes in nfs_release_page (Jeff Layton) [516490]
- [fs] nfs: Add debugging facility for NFS aoj@anic, regression, netlink socket usage (Eric Paris ) [434158]
- [net] eHEA: checksum error fix (Brad Peters ) [438212]
- [s390] fix qeth scatter-gather (Jan Glauber ) [438180]
- [ata] fix SATA IDE mode bug upon resume (Bhavana Nagendra ) [432652]
- [openib] update ipath driver (Doug Ledford ) [253023]
- [openib] update the nes driver from 0.4 to 1.0 (Doug Ledford ) [253023]
- [openib] IPoIB updates (Doug Ledford ) [253023]
- [openib] cleanup of the xrc patch removal (Doug Ledford ) [253023]
- [openib] remove srpt and empty vnic driver files (Doug Ledford ) [253023]
- [openib] enable IPoIB connect mode support (Doug Ledford ) [253023]
- [openib] SDP accounting fixes (Doug Ledford ) [253023]
- [openib] add improved error handling in srp driver (Doug Ledford ) [253023]
- [openib] minor core updates between rc1 and final (Doug Ledford ) [253023]
- [openib] update ehca driver to version 0.25 (Doug Ledford ) [253023]
- [openib] remove xrc support (Doug Ledford ) [253023]
- [ppc64] hardware watchpoints: add DABRX init (Brad Peters ) [438259]
- [ppc64] hardware watchpoints: add DABRX definitions (Brad Peters ) [438259]
- [x86_64] address space randomization (Peter Zijlstra ) [222473]
- [ppc64] fixes removal of virtual cpu from dlpar (Brad Peters ) [432846]
- [mm] inconsistent get_user_pages and memory mapped (Brad Peters ) [408781]
- [s390] add missing TLB flush to hugetlb_cow (Hans-Joachim Picht ) [433799]
- [xen] HV ignoring extended cpu model field (Geoff Gustafson ) [439254]
- [xen] oprofile: support for Penryn-class processors (Geoff Gustafson ) [253056]
- [xen] ia64: HV messages are not shown on VGA console (Tetsu Yamamoto ) [438789]
- [xen] ia64: ftp stress test fixes between HVM/Dom0 (Tetsu Yamamoto ) [426015]
- [xen] ia64: fix kernel panic on systems w/<=4GB RAM (Jarod Wilson ) [431001]- [scsi] qla4xxx: negotiation issues with new switches (Marcus Barrow ) [438032]
- [net] qla3xxx: have link SM use work threads (Marcus Barrow ) [409171]
- [scsi] qla4xxx: fix completion, lun reset code (Marcus Barrow ) [438214]
- [scsi] lpfc: update driver to 8.2.0.22 (Chip Coldwell ) [437050]
- [scsi] lpfc: update driver to 8.2.0.21 (Chip Coldwell ) [437050]
- [block] sg: cap reserved_size values at max_sectors (David Milburn ) [433481]
- Revert: [xen] idle=poll instead of hypercall block (Bill Burns ) [437252]
- [scsi] lpfc: update driver to 8.2.0.20 (Chip Coldwell ) [430600]
- [xen] add warning to 'time went backwards' message (Prarit Bhargava ) [436775]
- [x86] clear df flag for signal handlers (Jason Baron ) [436131]
- [usb] fix iaa watchdog notifications (Bhavana Nagendra ) [435670]
- [usb] new iaa watchdog timer (Bhavana Nagendra ) [435670]- [sound] HDMI device IDs for AMD ATI chipsets (Bhavana Nagendra ) [435658]
- [scsi] fusion: 1078 corrupts data in 36GB mem region (Chip Coldwell ) [436210]
- [GFS2] gfs2_adjust_quota has broken unstuffing code (Abhijith Das ) [434736]
- [docs] add oom_adj and oom_score use to proc.txt (Larry Woodman ) [277151]
- [GFS2] optimise loop in gfs2_bitfit (Bob Peterson ) [435456]
- [crypto] fix SA creation with ESP encryption-only (Thomas Graf ) [436267]
- [crypto] fix SA creation with AH (Thomas Graf ) [435243]
- [ppc64] spufs: invalidate SLB then add a new entry (Brad Peters ) [436336]
- [ppc64] SLB: serialize invalidation against loading (Brad Peters ) [436336]
- [ppc64] cell: remove SPU_CONTEXT_SWITCH_ACTIVE flag (Brad Peters ) [434155]
- Revert: [net] sunrpc: fix hang due to eventd deadlock (Jeff Layton ) [438044]
- [ppc64] broken MSI on cell blades when IOMMU is on (Brad Peters ) [430949]
- [cpufreq] powernow: blacklist bad acpi tables (Chris Lalancette ) [430947]
- [firmware] ibft_iscsi: prevent misconfigured iBFTs (Konrad Rzeszutek ) [430297]
- [xen] HV inside a FV guest, crashes the host (Bill Burns ) [436351]- [xen] ia64: fix kprobes slowdown on single step (Tetsu Yamamoto ) [434558]
- [xen] mprotect performance improvements (Rik van Riel ) [412731]
- [GFS2] remove assertion 'al->al_alloced' failed (Abhijith Das ) [432824]
- [misc] remove unneeded EXPORT_SYMBOLS (kH-@--- (#152955)
- fixed missing dnl on SMART_HOST define (#166680)
- fixed wrong location of aliases and aliases.db file in aliases man page
  (#166744)
- enabled CipherList config option for sendmail (#172352)
- added user chowns for /etc/mail/authinfo.db and move check for cf files
  (#184341)
- fixed Makefile of vacation (#191396)
  vacation is not included in this sendmail package
- /var/log/mail now belongs to sendmail (#192850)- rebuild- dropped reference to Red Hat Linux in sendmail-redhat.mc (#176679)- new version 8.13.7 (#195282)
- fixes CVE-2006-1173 (VU#146718): possible denial of service issue caused by
  malformed multipart messages (#195776)- new version 8.13.6 (fixes VU#834865)
- dropped libmilter-sigwait patch (fixed in 8.13.6)- fixed selinuxenabled path in initscript
- fixed error handling with sigwait (#137709)
  Thanks to Jonathan Kamens for the patch
- fixed prereq for cyrus-sasl: now using /usr/sbin/saslauthd
- appended 'dnl' to cert tags in sendmail.mc- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- rebuilt against new openssl- use include instead of pam_stack in pam config- new version 8.13.5
- fixed email address in changelog- using new certificates directory /etc/pki/tls/certs- added configuration example for Cyrus-IMAPd to sendmail.mc (#142001)
  Thanks to Alexander Dalloz- new version 8.13.4
- added requires for the sendmail base package in sendmail-cf, sendmail-devel
  and sendmail-doc
- dropped upstream close_wait.p2 patch- dropped direct support for bind: no bind in confLIBSEARCH anymore,
  using libresolv again- fix libbind include path - use /usr/include/bind/netdb.h, no
- /usr/include/netdb.h - bug: 150339- fixed gcc4 build: use double quotes for confOPTIMIZE to avoid m4 confusion
  with ','
- fix for ppc: using tripple-quotes- new version 8.13.3 with closewait.p2 patch- new version 8.13.2
- thanks to Robert Scheck for adapting the patches- rebuild against db-4.3.21.- added missing BuildRequires for groff (#134778)
- added socketmap support (#131906)- applied Sendmail Errata (2004-08-24): errata_cataddr (#131179)- new version 1.13.1- fixed init script to not complain missing sendmail-cf package (#126975)
- better message in /etc/mail/Makefile for missing sendmail-cf package.- new version 8.13.0
- made /etc/mail/Makefile complain missing sendmail-cf package (#123348)
- fixed ownership of %{_includedir}/libmilter (#73977)
- moved back to /usr/share/ssl/certs as certificate directory (see sendmail.mc)
- extended sendmail.mc for spam protection- rebuilt- Fix selinuxenabled location- Fix security context of pid file for selinux- fixed alternatives slave for sendmail.sendmail- set path to cyrus-imapd deliver- fixed spec file- added authinfo to possible sendmail maps: /etc/mail/Makefile (#119010)
- fixed minor version in changelog- new slave in alternatives for sendmail man page- rebuilt- removed buildreq for gdbm-devel- RH3.0E version: sasl1, no pie, old_setup (provide /etc/aliases)
- new switches for pie and old_setup- new Sendmail.conf for sasl1 (#114726)- added information for saslauthd and AUTH (#113463)
- fixed STATUS_FILE in sendmail-redhat.mc (#114302)
- reset mta after update if mta was sendmail (#114257)
- enabled pie for ia64 again- removed /etc/aliases (now in setup)- /usr/lib/sendmail is in alternatives, now
- removed trailing / from stdir
- fixed define for STATUS_FILE- disabled pie for ia64- new version 8.12.11
- pie- fc2 version (with sasl2)- reverted to sasl1 for 3.0E: added with_sasl1
- spec file cleanup
- new location for statistics file (/var/log/)- Fix download url.- rebuild against db-4.2.52.- fix pam alternatives handling
- add patch from Jakub Jelinek for PIE- fix usage of RPM_OPT_FLAGS variable in spec file
- add makecert.sh script to -doc subpackage
- add cert paths to sendmail.mc- fix alternatives (#109313)
- enable TLS- add some more system account entries into /etc/aliases
- add example for a mixed IPv6/IPv4 setup- added with_ options- rebu	k@9m ^GVV
SF+L,
20|
T	)m
;(#H'	_TfBE#3#7F\[\	
	+,?ZB,9G
۠wO P_SEE7:I\K\K14(1RRR+JR+Fq+C^Y4@YJTTGZ14Z^YGYii^Y,B*GZ1ZR9@g9E$'J](]})LL/0b/CV+BB+K@/+@:XX''3&23'#)F***w4^GZ)ZZ''6YbY`Rb(R+YY4<t.Z)+ lL	dI#	e\JxoFdr/uRRX,Dv`~
*?
#R[e4=	NyYM{PRlT	]?		$i#z}~zPB{	n{Au*V
_;z
<92	/%
<@! 2DO]s%G
E
",W U	G2z"S7	
-!.M6T?	K"6	
^"5jt! 7B>p
(=	*J'G^V!I\F
#"
`[~*[<)
q%
<0$V~%!
eF<j"'*F~J@6zM6K
F
k	7#iD
AP!	?sBJ*"p)jMY2*
[0.y<
oi9

J 4v	_b./|t$	z)o$#}.$
=4>&)pa"L5bh80&3hx8:kG ;	r
Ա+,?/>'G3lV"A
k
	iN_k,tT!c
C(	#	}
>	0oe-)
JRR)A
a#	bu7I}a	t1fD6.3f
/%
	(`1
?6dva7siKR?s'
	uK9f'Ffe	E4X!ft]
	]\x#PMZw.b"3q
"^e1z]E:.7t
+%!FR;W#MvRL!\C 
;36m77^k}muk6v68rcjMoKumuqpnv~S_$_*
A큤AAA큤AA큤A큤AAA큤AA큤A큤AAA큤AA큤A큤AA큤AA큤AAA큤A큤A큤AkY-@---*needs* it then?- made /etc/mail/deny.db a ghost
- removed preun that used to remove deny.db (ghost handles that now)
- NOTE: upgrading from the sendmail packages in 4.8, 4.8.1, and possibly
  4.9 (all Red Hat betas between 4.2 and 5.0) could cause problems.  You
  may need to do a makemap in /etc/mail and a newaliases after upgrading
  from those packages.  Upgrading from 4.2 or prior should be fine.- made aliases.db a ghost- fixed preuninstall script to handle aliases.db on upgrades properly- fixed post-install output and changed /var/spool/mqueue to 755- fixed /usr/lib/sendmail-cf paths- updated to 8.8.7
- added some spam filtration
- combined some makefile patches
- added BuildRoot support- marked initscript symlinks as missingok
- run newalises after creating /var/spool/mqueue- built against glibc, udated release to -6 (skipped -5!)- Added -nsl on the Alpha (for glibc to provide NIS functions).- Added nis support./bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/bin/shbuilder17.centos.org 1426495329AJjJRJJJMJNJOJkJJPJQJJ|JnJJJKJLBBAABBBBBBBJTBBBBBBBBBBBBBBJlJmJoJ8.13.8-10.el5_118.13.8-10.el5_11		

aliases.dbmailMakefileaccessaccess.dbdomaintabledomaintable.dbhelpfilelocal-host-namesmailertablemailertable.dbsendmail.cfsendmail.mcsubmit.cfsubmit.mctrusted-usersvirtusertablevirtusertable.dbsmtp.sendmailsendmailsmrshsendmailhoststatmailq.sendmailmakemapnewaliases.sendmailpurgestatrmail.sendmailsendmail.sendmailSendmail.confmailstatsmakemappraliasessendmail.sendmailsmrshmailq.sendmail.1.gznewaliases.sendmail.1.gzaliases.sendmail.5.gzmailstats.8.gzmakemap.8.gzpraliases.8.gzrmail.8.gzsendmail.sendmail.8.gzsmrsh.8.gzmailstatisticsclientmqueuemqueue/etc//etc/mail//etc/pam.d//etc/rc.d/init.d//etc/sysconfig//usr/bin//usr/lib//usr/lib64/sasl2//usr/sbin//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8//var/log//var/log/mail//var/spool/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnu			
	ASCII English textASCII textBerkeley DB (Hash, version 8, native byte-order)Bourne-Again shell script text executableELF 64-bit LSB shared object, AMD x86-64, version 1 (SYSV), strippedbroken symbolic link to `../../usr/sbin/sendmail'broken symbolic link to `../sbin/sendmail'directoryemptysymbolic link to `../../usr/sbin/makemap'!1ATRRRRRRRRRRRRRRRR R'RRRRRRRRRRRRRRR R'RRRRRRRRRRRRRRR R'RRRRRRRRRRRRl.@...otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsendmail-8.13.8-10.el5_11.src.rpmsendmail-cf@JJ/bin/shm4rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)sendmail3.0.4-14.0-18.13.8-10.el5_114.4.2.3T-L`KZKX`KGEl`DD`DDYDpD`D`D!CG`CC`C`CsCJ`C/4B{Bp`B\DB9B0`B$AAVAA~A6F`A`@7@Z`@q`@@ty@m`@l@k?`@k?`@X`@E@51@51@"@0@@G@`@
@@?`?ۋ???"`?`??se`?j*?h`?S`?4`?(???>k>%>>$>>>`>h>">fs`>Z>Z>Z>Ir`>/`>/`>#6>!`> >`=`==b=y=Ŝ`=J=`=`=n`=@t=?#`=?#`=-= ===r<f`<`<`<<`<<<<4`<~`<z<t`<t`<[<Y`<Y`<M<><<`<;;7;;;|;s;o`;];\`;Kz;`:::#`::`::Q`::`:`:oP`:m:_~`:Z8`:T`9`9a`99k91`9<99~
9~
9wv`9l`9h9g`9b^`9]`9S9Q:9MF`9B`9%`9$g9`88o`8o`8`88F7͡7P`7P`77}6`7`7U7	2`666`6k66`6P6`6`5(`5O5K`5JE4W4Q`4F`4<`49_`4(;44i44
3q`3A`3IJaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-10Jaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-9Jaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-8Jaroslav Škarvada <jskarvad@redhat.com> - 8.13.8-7Miroslav Lichvar <mlichvar@redhat.com> 8.13.8-6.el5Thomas Woerner <twoerner@redhat.com> 8.13.8-2Florian La Roche <laroche@redhat.com>Thomas Woerner <twoerner@redhat.com> 8.13.8-1Thomas Woerner <twoerner@redhat.com> 8.13.7-3.1Thomas Woerner <twoerner@redhat.com> 8.13.7-3Jesse Keating <jkeating@redhat.com> - 8.13.7-2.1Thomas Woerner <twoerner@redhat.com> 8.13.7-2Thomas Woerner <twoerner@redhat.com> 8.13.7-1Thomas Woerner <twoerner@redhat.com> 8.13.6-1Thomas Woerner <twoerner@redhat.com> 8.13.5-3Jesse Keating <jkeating@redhat.com> - 8.13.5-2.2.1Jesse Keating <jkeating@redhat.com> - 8.13.5-2.2Jesse Keating <jkeating@redhat.com>Tomas Mraz <tmraz@redhat.com> 8.13.5-2Tomas Mraz <tmraz@redhat.com>Thomas Woerner <twoerner@redhat.com> 8.13.5-1Thomas Woerner <twoerner@redhat.com> 8.13.4-2Thomas Woerner <twoerrner@redhat.com> 8.13.4-1.1Thomas Woerner <twoerner@redhat.com> 8.13.4-1Thomas Woerner <twoerner@redhat.com> 8.13.3-2Jason Vas Dias <jvdias@redhat.com> 8.13.3-1.2Thomas Woerner <twoerner@redhat.com> 8.13.3-1.1Thomas Woerner <twoerner@redhat.com> 8.13.3-1Thomas Woerner <twoerner@redhat.com> 8.13.2-1Jeff Johnson <jbj@jbj.org> 8.13.1-2.2Thomas Woerner <twoerner@redhat.com> 8.13.1-2.1Thomas Woerner <twoerner@redhat.com> 8.13.1-2Thomas Woerner <twoerner@redhat.com> 8.13.1-1Thomas Woernj @@law Gruszka) [582367]- [fs] getrusage: fill ru_maxrss value (Amerigo Wang) [466157]
- [net] bonding: fix broken multicast with round-robin mode (Andy Gospodarek) [570645]
- [usb] input: fix keyboard LEDs on all the time (Pete Zaitcev) [513934]
- [x86_64] fix time drift due to faulty lost tick tracking (Ulrich Obergfell) [579711]
- [cciss] remove extraneous printk (Tomas Henzl) [582465]
- [sunrpc] fix AUTH_SYS using sec=sys export option (Sachin Prabhu) [573652]
- [misc] fix itimers periodic tics precision (Stanislaw Gruszka) [441134]
- [net] tg3: fix INTx fallback when MSI fails (Steve Best) [587666]
- [fs] quota: fix possible infinite loop in quota code (Eric Sandeen) [546060]
- [misc] add {thread,core}_siblings_list to /sys (Prarit Bhargava) [570610]
- [misc] add /sys/devices/system/node/nodeX/cpulist files (Prarit Bhargava) [572285]
- [net] tun: orphan an skb on tx (Michael S. Tsirkin) [584412]
- [edac] fix panic when a corrected error happens on i5000 (Mauro Carvalho Chehab) [533391]
- [net] iwlwifi: re-enable IWLWIFI_LEDS (John Linville) [582003]
- [net] calc TCP's connection closethreshold as time value (Jiri Pirko) [582722]
- [net] sched: fix SFQ qdisc crash w/limit of 2 packets (Jiri Pirko) [579774]
- [net] missed and reordered checks in {arp,ip,ip6}_tables (Jiri Pirko) [554563]
- [net] neigh: fix state transitions via Netlink request (Jiri Pirko) [485903]
- [net] route: fix BUG_ON in rt_secret_rebuild_oneshot (Jiri Olsa) [566104]
- [net] netfilter: fix vmalloc ENOMEM caused by iptables (Jiri Olsa) [570491]
- [block] cciss: fix multi-line printk log level (Jerome Marchand) [556921]
- [nfs] revert retcode check in nfs_revalidate_mapping() (Jeff Layton) [557423]
- [nfs] don't decode GETATTR if DELEGRETURN returned error (Jeff Layton) [551028]
- [md] dm-log: fix bad log status after failure (Jonathan E Brassow) [570583]
- [net] igmp: fix ip_mc_sf_allow race (Flavio Leitner) [552886]
- [hwmon] add 0x prefix to hex coretemp module output (Dean Nelson) [571864]
- [net] e1000e: fix WoL init when WoL disabled in EEPROM (Dean Nelson) [568562]
- [ata] libata: handle semb signature (David Milburn) [533093]
- [ata] libata-acpi: missing _SDD is not an error (David Milburn) [559815]
- [scsi] sg: rate limit warning (Doug Ledford) [536937]
- [net] tun: check supplemental groups in TUN/TAP driver (Danny Feng) [540786]
- [s390] nss: add missing .previous call to asm function (Hendrik Brueckner) [581522]
- [misc] lockdep: dump stack when hitting a limit (Amerigo Wang) [546554]
- [net] ipv6: don't panic when kmem_cache_create fails (Amerigo Wang) [555338]
- [misc] ipc: HARD_MSGMAX should be higher on 64bit (Amerigo Wang) [548334]
- [fs] gfs2: make quota file size a multiple of gfs2_quota (Abhijith Das) [546455]- [mm] fix hugepage corruption using vm.drop_caches (Larry Woodman) [579469]
- [misc] taskstats: enable CONFIG_TASK_XACCT (Jiri Olsa) [516961]
- [misc] taskstats: new structure/cmd to avoid KABI break (Jiri Olsa) [516961]
- [misc] taskstats: common fix for KABI breakage (Jiri Olsa) [516961]
- [misc] taskstats: upgrade to version 4 (Jiri Olsa) [516961]
- [misc] futex: handle futex value corruption gracefully (Jerome Marchand) [480396] {CVE-2010-0622}
- [misc] futex: handle user space corruption gracefully (Jerome Marchand) [480396] {CVE-2010-0622}
- [misc] futex: fix fault handling in futex_lock_pi (Jerome Marchand) [480396] {CVE-2010-0622}
- [x86] utrace: block-step fix (Jerome Marchand) [463950]
- [nfs] don't unhash dentry in nfs_lookup_revalidate (Jeff Layton) [582321]
- [net] sunrpc: fix panic when reloading rpcsec_gss_krb5 (Harshula Jayasuriya) [570044]
- [net] bonding: fix updating of speed/duplex changes (Andy Gospodarek) [567604]
- [net] e1000: fix WoL init when WoL disabled in EEPROM (Dean Nelson) [568561]
- [ata] ahci: support FIS-based switching (David Milburn) [474294]
- [audit] make sure filterkey rules are reported (Alexander Viro) [579479]
- [audit] clean up rule ordering, part 2 (Alexander Viro) [579479]
- [audit] clean up rule ordering, part 1 (Alexander Viro) [579479]
- [audit] fix k{U@ssions for /dev/cdrom to 0400 in console.perms- fixed a few bugs in pam_console- pam_console authentication working
- added /etc/security/console.apps directory- added pam_console files to filelist- upgraded to 0.66, some source cleanups- add patch from Savochkin Andrey Vladimirovich <saw@msu.ru> for umask
  security risk- upgrade to ver 0.65
- build the package out of internal CVS serverbuilder17.centos.org 1432734026B}B~BBBBBBBBBFF!F FFFFFFFFFFFFFFFF
FFFFFFF	FFFFF
FFFFFFFFFFFFFFFFFFFFFFF^FRFcFnFkFLFZFbFIFgFPFMFiFdF_FGFOFTFhFWF]FKFcFVFbF[FNF\FSF`FaFdFHFlFUFmFQFF0.99.6.2-14.el5_11security_pam_compat.h_pam_macros.h_pam_types.hpam_appl.hpam_client.hpam_ext.hpam_filter.hpam_misc.hpam_modules.hpam_modutil.hlibpam.solibpam_misc.solibpamc.sopam-devel-0.99.6.2Linux-PAM_ADG.txtLinux-PAM_MWG.txthtmlLinux-PAM_ADG.htmlLinux-PAM_MWG.htmladg-author.htmladg-copyright.htmladg-example.htmladg-files.htmladg-glossary.htmladg-interface-by-app-expected.htmladg-interface-of-app-expected.htmladg-interface-programming-notes.htmladg-interface.htmladg-introduction-description.htmladg-introduction-synopsis.htmladg-introduction.htmladg-libpam-functions.htmladg-libpam_misc.htmladg-overview.htmladg-porting.htmladg-security-conv-function.htmladg-security-library-calls.htmladg-security-resources.htmladg-security-service-name.htmladg-security-usre-identity.htmladg-security.htmladg-see-also.htmlmwg-author.htmlmwg-copyright.htmlmwg-example.htmlmwg-expected-by-module-item.htmlmwg-expected-by-module-other.htmlmwg-expected-by-module.htmlmwg-expected-of-module-acct.htmlmwg-expected-of-module-auth.htmlmwg-expected-of-module-chauthtok.htmlmwg-expected-of-module-overview.htmlmwg-expected-of-module-session.htmlmwg-expected-of-module.htmlmwg-introduction-description.htmlmwg-introduction.htmlmwg-introducton-synopsis.htmlmwg-see-also.htmlmwg-see-options.htmlmwg-see-programming-libs.htmlmwg-see-programming-sec.htmlmwg-see-programming-syslog.htmlmwg-see-programming.htmlmisc_conv.3.gzpam.3.gzpam_acct_mgmt.3.gzpam_authenticate.3.gzpam_chauthtok.3.gzpam_close_session.3.gzpam_conv.3.gzpam_end.3.gzpam_error.3.gzpam_fail_delay.3.gzpam_get_data.3.gzpam_get_item.3.gzpam_get_user.3.gzpam_getenv.3.gzpam_getenvlist.3.gzpam_info.3.gzpam_misc_drop_env.3.gzpam_misc_paste_env.3.gzpam_misc_setenv.3.gzpam_open_session.3.gzpam_prompt.3.gzpam_putenv.3.gzpam_set_data.3.gzpam_set_item.3.gzpam_setcred.3.gzpam_sm_acct_mgmt.3.gzpam_sm_authenticate.3.gzpam_sm_chauthtok.3.gzpam_sm_close_session.3.gzpam_sm_open_session.3.gzpam_sm_setcred.3.gzpam_start.3.gzpam_strerror.3.gzpam_syslog.3.gzpam_verror.3.gzpam_vinfo.3.gzpam_vprompt.3.gzpam_vsyslog.3.gz/usr/include//usr/include/security//usr/lib//usr/share/doc//usr/share/doc/pam-devel-0.99.6.2//usr/share/doc/pam-devel-0.99.6.2/html//usr/share/m)ki@h.vimsicad.vimsieve.vimsimula.vimsinda.vimsindacmp.vimsindaout.vimsisu.vimskill.vimsl.vimslang.vimslice.vimslpconf.vimslpreg.vimslpspi.vimslrnrc.vimslrnsc.vimsm.vimsmarty.vimsmcl.vimsmil.vimsmith.vimsml.vimsnnsnet.vimsnnspat.vimsnnsres.vimsnobol4.vimspec.vimspecman.vimspice.vimsplint.vimspup.vimspyce.vimsql.vimsqlanywhere.vimsqlforms.vimsqlinformix.vimsqlj.vimsqloracle.vimsqr.vimsquid.vimsshconfig.vimsshdconfig.vimst.vimstata.vimstp.vimstrace.vimsudoers.vimsvn.vimsyncolor.vimsynload.vimsyntax.vimsysctl.vimtads.vimtags.vimtak.vimtakcmp.vimtakout.vimtar.vimtasm.vimtcl.vimtcsh.vimterminfo.vimtex.vimtexinfo.vimtexmf.vimtf.vimtidy.vimtilde.vimtli.vimtpp.vimtrasys.vimtrustees.vimtsalt.vimtsscl.vimtssgm.vimtssop.vimuc.vimudevconf.vimudevperm.vimudevrules.vimuil.vimupdatedb.vimvalgrind.vimvb.vimvera.vimverilog.vimverilogams.vimvgrindefs.vimvhdl.vimvim.vimviminfo.vimvirata.vimvmasm.vimvrml.vimvsejcl.vimwdiff.vimweb.vimwebmacro.vimwget.vimwhitespace.vimwinbatch.vimwml.vimwsh.vimwsml.vimwvdial.vimxdefaults.vimxf86conf.vimxhtml.vimxinetd.vimxkb.vimxmath.vimxml.vimxmodmap.vimxpm.vimxpm2.vimxquery.vimxs.vimxsd.vimxslt.vimxxd.vimyacc.vimyaml.vimz8a.vimzsh.vimtoolsREADME.txtblink.cccfilter.1ccfilter.cccfilter_README.txtefm_filter.plefm_filter.txtefm_perl.plmve.awkmve.txtpltags.plrefshtags.1shtags.plvim132vim_vs_net.cmdvimmvimspell.shvimspell.txtxcmdsrv_client.ctutorREADME.gr.cp737.txtREADME.gr.txtREADME.txttutortutor.catutor.detutor.estutor.frtutor.grtutor.gr.cp737tutor.gr.utf-8tutor.gr.utf-8~tutor.ittutor.ja.euctutor.ja.sjistutor.ja.utf-8tutor.ko.euctutor.ko.utf-8tutor.notutor.pltutor.pl.cp1250tutor.pl.utf-8tutor.rututor.ru.cp1251tutor.ru.utf-8tutor.sktutor.sk.cp1250tutor.svtutor.tr.iso9tutor.tr.utf-8tutor.vi.utf-8tutor.vimtutor.zh.big5tutor.zh.eucvimrc_example.vim/etc//usr/bin//usr/share/doc//usr/share/doc/vim-common-7.0.109//usr/share/man//usr/share/man/fr.ISO8859-1//usr/share/man/fr.ISO8859-1/man1//usr/share/man/fr.UTF-8//usr/share/man/fr.UTF-8/man1//usr/share/man/fr//usr/share/man/fr/man1//usr/share/man/it.ISO8859-1//usr/share/man/it.ISO8859-1/man1//usr/share/man/it.UTF-8//usr/share/man/it.UTF-8/man1//usr/share/man/it//usr/share/man/it/man1//usr/share/man/man1//usr/share/man/pl.ISO8859-2//usr/share/man/pl.ISO8859-2/man1//usr/share/man/pl.UTF-8//usr/share/man/pl.UTF-8/man1//usr/share/man/pl//usr/share/man/pl/man1//usr/share/man/ru.KOI8-R//usr/share/man/ru.KOI8-R/man1//usr/share/man/ru.UTF-8//usr/share/man/ru.UTF-8/man1//usr/share//usr/share/vim//usr/share/vim/vim70//usr/share/vim/vim70/autoload//usr/share/vim/vim70/autoload/xml//usr/share/vim/vim70/colors//usr/share/vim/vim70/compiler//usr/share/vim/vim70/doc//usr/share/vim/vim70/ftplugin//usr/share/vim/vim70/indent//usr/share/vim/vim70/keymap//usr/share/vim/vim70/lang//usr/share/vim/vim70/lang/af//usr/share/vim/vim70/lang/af/LC_MESSAGES//usr/share/vim/vim70/lang/ca//usr/share/vim/vim70/lang/ca/LC_MESSAGES//usr/share/vim/vim70/lang/cs//usr/share/vim/vim70/lang/cs/LC_MESSAGES//usr/share/vim/vim70/lang/de//usr/share/vim/vim70/lang/de/LC_MESSAGES//usr/share/vim/vim70/lang/en_GB//usr/share/vim/vim70/lang/en_GB/LC_MESSAGES//usr/share/vim/vim70/lang/es//usr/share/vim/vim70/lang/es/LC_MESSAGES//usr/share/vim/vim70/lang/fr//usr/share/vim/vim70/lang/fr/LC_MESSAGES//usr/share/vim/vim70/lang/ga//usr/share/vim/vim70/lang/ga/LC_MESSAGES//usr/share/vim/vim70/lang/it//usr/share/vim/vim70/lang/it/LC_MESSAGES//usr/share/vim/vim70/lang/ja//usr/share/vim/vim70/lang/ja/LC_MESSAGES//usr/share/vim/vim70/lang/ko//usr/share/vim/vim70/lang/ko/LC_MESSAGES//usr/share/vim/vim70/lang/no//usr/share/vim/vim70/lang/no/LC_MESSAGES//usr/share/vim/vim70/lang/pl//usr/share/vim/vim70/lang/pl/LC_MESSAGES//usr/share/vim/vim70/lang/ru//usr/share/vim/vim70/lang/ru/LC_MESSAGES//usr/share/vim/vim70/lang/sk//usr/share/vim/vim70/lang/sk/LC_MESSAGES//usr/k @d1H11111112111111J1;1>181$1<1:1D141(111,1=161@1&151+1#1/101A1*1-1.1?1%13191)1"171'/usr6.6-9.el5pcre-configpcre.hpcre_scanner.hpcre_stringpiece.hpcrecpp.hpcrecpparg.hpcreposix.hlibpcre.alibpcre.solibpcrecpp.alibpcrecpp.solibpcreposix.alibpcreposix.solibpcre.pcpcre.3.gzpcre_compile.3.gzpcre_compile2.3.gzpcre_config.3.gzpcre_copy_named_substring.3.gzpcre_copy_substring.3.gzpcre_dfa_exec.3.gzpcre_exec.3.gzpcre_free_substring.3.gzpcre_free_substring_list.3.gzpcre_fullinfo.3.gzpcre_get_named_substring.3.gzpcre_get_stringnumber.3.gzpcre_get_substring.3.gzpcre_get_substring_list.3.gzpcre_info.3.gzpcre_maketables.3.gzpcre_refcount.3.gzpcre_study.3.gzpcre_version.3.gzpcreapi.3.gzpcrebuild.3.gzpcrecallout.3.gzpcrecompat.3.gzpcrecpp.3.gzpcrematching.3.gzpcrepartial.3.gzpcrepattern.3.gzpcreperform.3.gzpcreposix.3.gzpcreprecompile.3.gzpcresample.3.gz/usr/bin//usr/include//usr/lib//usr/lib/pkgconfig//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i386 -mtune=generic -fasynchronous-unwind-tablescpiogzip9i386i386-redhat-linux-gnu	ASCII C program textASCII C++ program textASCII textBourne shell script text executablecurrent ar archivedirectorysymbolic link to `../../lib/libpcre.so.0'symbolic link to `libpcrecpp.so.0.0.0'symbolic link to `libpcreposix.so.0.0.0'RRRR?PӉ>?RKiGV(U1^'f`V%0D@EixxJ`	?RKiGV(1%"c.C?f8ji0:.&ԻVAL, '7215bf0e100ecb24e95ce71a72b81f3578823810\=DD/usr\<es (#430856).
  - libbfd.a symbols visibility is now hidden (suggested by Jakub Jelinek).
- Fix PGI cross-files DW_FORM_ref_addr relocations
  (fix by Jakub Jelinek, #438793).
- Restore the RHEL-5.0 debug symbols linking performance (Jakub Jelinek,
  H.J. Lu, #364141).- full power6 support (Alan Modra, Peter Bergner, Ben Elliston,
  Anton Blanchard, #253108)
- demangle ppc64 dot symbols in gprof (Jan Kratochvil, #242057)
- SSE5 support in gas and objdump (Michael Meissner, Dwarakanath Rajagopal,
  Tony Linthicum, H.J.Lu, #426906)- fix ld --unique with new DWARF3 sections .debug_ranges and .debug_pubtypes
  (Alan Modra, #241252)
- fix segfault in ppc64 version script handling (Andreas Schwab)- 10x linking speedup on large C++ apps (#223181)
- fix tekhex reader
- SSE4 support in gas and objdump (H.J.Lu, #223120)
- compile binutils with -D_FILE_OFFSET_BITS=64 (#215514)
- fix ld --emit-relocs on ppc64 (Alan Modra, #235221)
- fix ppc32 ld segfault with -msecure-plt (Alan Modra, BZ#4267)- fix popcnt instruction assembly and disassembly on amd64 (#214767)- update to 2.17.50.0.6
  - fix for section relative linker script defined symbols inl30@000`O'NG`K;K:I`Hq`HwH^`GGi`G~`F\`E5E`EEfEQEKEKEE$`E6E0`E`E	DDDDDD۬`DD7`DYDpD5`DkDhDhDaD:`D`Dv`CCCC`CCCκ`C`C`C`C CVCUp`CTCTC<cC `C`C`BIBwBՎB`B`Bq\Bd-BQB/qB*+AAK`AI`AQA8`A4@7@q`@l@V'`@O@E@=@-H@0?`?^M`?M)?C`?`?	`>k>Mf>/`>->M=b=X/=R=C==`=[=
`=,<<Z<`<`<`<`<Xl<UJan Horak <jhorak@redhat.com> - 2.16.0-30Jan Horak <jhorak@redhat.com> - 2.16.0-29Martin Stransky <stransky@redhat.com> - 2.16.0-27Jan Horak <jhorak@redhat.com> - 2.16.0-26Martin Stransky <stransky@redhat.com> - 2.16.0-25Martin Stransky <stransky@redhat.com> - 2.16.0-22Martin Stransky <stransky@redhat.com> - 2.16.0-21Martin Stransky <stransky@redhat.com> - 2.16.0-20Martin Stransky <stransky@redhat.com> - 2.16.0-19Martin Stransky <stransky@redhat.com> - 2.16.0-18Martin Stransky <stransky@redhat.com> - 2.16.0-17Martin Stransky <stransky@redhat.com> - 2.16.0-16Christopher Aillon <caillon@redhat.com> - 2.16.0-15Martin Stransky <stransky@redhat.com> - 2.16.0-14.0.1Christopher Aillon <caillon@redhat.com> - 2.16.0.13Matthias Clasen <mclasen@redhat.com> - 2.16.0-12Matthias Clasen <mclasen@redhat.com> - 2.16.0-11Christopher Aillon <caillon@redhat.com> - 2.16.0-10Matthias Clasen <mclasen@redhat.com> - 2.16.0-9Matthias Clasen <mclasen@redhat.com> - 2.16.0-8Matthias Clasen <mclasen@redhat.com> - 2.16.0-7Matthias Clasen <mclasen@redhat.com> - 2.16.0-6Alexander Larsson <alex@redhat.com> - 2.16.0-5.el5Alexander Larsson <alexl@redhat.com> - 2.16.0-4.el5Christopher Aillon <caillon@redhat.com> - 2.16.0-3.fc6Matthias Clasen  <mclasen@redhat.com> - 2.16.0-2.fc6Matthias Clasen  <mclasen@redhat.com> - 2.16.0-1.fc6Matthias Clasen  <mclasen@redhat.com> - 2.15.91-3.fc6Matthew Barnes <mbarnes@redhat.com> - 2.15.91-2Matthew Barnes <mbarnes@redhat.com> - 2.15.91-1Jeremy Katz <katzj@redhat.com> - 2.15.5-1.el5Matthias Clasen <mclasen@redhat.com> - 2.15.5-1Matthias Clasen <mclasen@redhat.com> - 2.15.2-2Jesse Keating <jkeating@redhat.com> - 2.15.3-1.1Matthias Clasen <mclasen@redhat.com> - 2.15.3-1Matthias Clasen <mclasen@redhat.com> - 2.15.2-1Matthew Barnes <mbarnes@redhat.com> - 2.15.1-3Matthew Barnes <mbarnes@redhat.com> - 2.15.1-2Matthias Clasen <mclasen@redhat.com> - 2.15.1-1Matthias Clasen <mclasen@redhat.com> - 2.14.1-2Matthias Clasen <mclasen@redhat.com> - 2.14.0-1Matthias Clasen <mclasen@redhat.com> - 2.13.6-1Matthias Clasen <mclasen@redhat.com> - 2.13.5-2Matthias Clasen <mclasen@redhat.com> - 2.13.5-1Jesse Keating <jkeating@redhat.com> - 2.13.4-1.2Jesse Keating <jkeating@redhat.com> - 2.13.4-1.1Matthias Clasen <mclasen@redhat.com> - 2.13.4-1Matthias Clasen <mclasen@redhat.com> - 2.13.3-1Matthias Clasen <mclasen@redhat.com> - 2.13.2-3David Malcolm <dmalcolm@redhat.com> - 2.13.2-2Matthias Clasen <mclasen@redhat.com> 2.13.2-1Jesse Keating <jkeating@redhat.com>Matthias Clasen <mclasen@redhat.com> - 2.13.1-6Jeremy Katz <katzj@redhat.com> - 2.12.1-5Christopher Aillon <caillon@redhat.com> - 2.12.1-4Matthias Clasen <mclasen@redhat.com> - 2.12.1-3Matthias Clasen <mclasen@redhat.com> - 2.12.1-2Matthias Clasen <mclasen@redhat.com> - 2.12.1-1Matthias Clasen <mclasen@redhat.com> - 2.12.0-1Jeremy Katz <katzj@redhat.com> - 2.11.1-5Ray Strode <rstrode@redhat.com> 2.11.1-4Christopher Aillon <caillon@redhat.com> 2.11.1-3Christopher Aillon <caillon@redhat.com> 2.11.1-2Matthias Clasen <mclasen@redhat.com> 2.11.1-1Ray Strode <rstrode@redhat.com> 2.10.0-1Christopher Aillon <caillon@redhat.com> 2.9.3-7Ray Strode <rstrode@redhat.com> 2.9.3-6Ray Strode <rstrode@redhat.com> 2.9.3-5Ray Strode <rstrode@redhat.com> 2.9.3-4Christopher Aillon <caillon@redhat.com> 2.9.3-3Christopher Aillon <caillon@redhat.com> 2.9.3-2Matthias Clasen <mclasen@redhat.com> 2.9.3-1Christopher Aillon <caillon@redhat.com> 2.6.5-1Marco Pesenti Gritti <mpg@redhat.com> 2.6.4-1Christopher Aillon <caillon@redhat.com> 2.6.3-1Matthias Clasen <mclasen@redhat.cojeA@_sa_expire return code error (Eric Paris ) [230620]
- [net] NetLabel: Verify sensitivity level has a valid CIPSO mapping (Eric Paris ) [230255]
- [audit] pfkey_delete and xfrm_del_sa audit hooks wrong (Eric Paris ) [229732]
- [block] Fix NULL bio crash in loop worker thread (Eric Sandeen ) [236880]
- [x86]: Add Greyhound performance counter events (Bhavana Nagendra ) [222126]
- [dio] clean up completion phase of direct_io_worker() (Jeff Moyer ) [242116]
- [audit] add subtrees support (Alexander Viro ) [182624]
- [audit] AVC_PATH handling (Alexander Viro ) [224620]
- [audit] auditing ptrace (Alexander Viro ) [228384]
- [x86_64] Fix a cast in the lost ticks code (Prarit Bhargava ) [241781]
- [PPC64] DMA 4GB boundary protection  (Scott Moser ) [239569]
- [PPC64] MSI support for PCI-E (Scott Moser ) [228081]
- [ppc64] Enable DLPAR support for HEA (Scott Moser ) [237858]
- [ppc64] update ehea driver to latest version. (Janice M. Girouard ) [234225]
- [PPC64] spufs move to sdk2.1 (Scott Moser ) [242763]
- [PPC64] Cell SPE and Performance (Scott Moser ) [228128]
- [cpufreq] Identifies correct number of processors in powernow-k8 (Bhavana Nagendra ) [229716]- [ipmi] update to latest (Peter Martuccelli ) [241928 212415 231436]
- [sata] super-jumbo update (Jeff Garzik ) [203781]
- [sata] move SATA drivers to drivers/ata (Jeff Garzik ) [203781]- [dlm] Allow unprivileged users to create the default lockspace (Patrick Caulfield ) [241902]
- [dlm] fix queue_work oops (David Teigland ) [242070]
- [dlm] misc device removed when lockspace removal fails (David Teigland ) [241817]
- [dlm] dumping master locks (David Teigland ) [241821]
- [dlm] canceling deadlocked lock (David Teigland ) [238898]
- [dlm] wait for config check during join (David Teigland ) [206520]
- [dlm] fix new_lockspace error exit (David Teigland ) [241819]
- [dlm] cancel in conversion deadlock (David Teigland ) [238898]
- [dlm] add lock timeouts and time warning (David Teigland ) [238898]
- [dlm] block scand during recovery (David Teigland ) [238898]
- [dlm] consolidate transport protocols (David Teigland ) [219799]
- [audit] log targets of signals (Alexander Viro ) [228366]- [scsi] Add kernel support for Areca RAID controllers (Tomas Henzl ) [205897]
- [s390] runtime switch for qdio performance statistics (Jan Glauber ) [228048]
- [nfs] enable 'nosharecache' mounts. (Steve Dickson ) [209964]
- [scsi] scsi_error.c - Fix lost EH commands (Chip Coldwell ) [227586]
- [s390] zfcp driver fixes (Jan Glauber ) [232002 232006]
- [misc] synclink_gt: fix init error handling  (Eric Sandeen) [210389]
- [edac] k8_edac: don't panic on PCC check (Aristeu Rozanski ) [237950]
- [mm] Prevent OOM-kill of unkillable children or siblings (Larry Woodman ) [222492]
- [aio] fix buggy put_ioctx call in aio_complete (Jeff Moyer ) [219497]
- [scsi] 3ware 9650SE not recognized by updated  3w-9xxx module (Chip Coldwell ) [223465]
- [scsi] megaraid: update version reported by  MEGAIOC_QDRVRVER (Chip Coldwell ) [237151]
- [nfs] NFS/NLM - Fix double free in __nlm_async_call (Steve Dickson ) [223248]
- [ppc] EEH is improperly enabled for some Power4  systems (Scott Moser ) [225481]
- [net] ixgb: update to 1.0.109 to add pci error recovery (Andy Gospodarek ) [211380]
- [ppc] Fix xmon=off and cleanup xmon initialization (Scott Moser ) [229593]
- [mm] reduce MADV_DONTNEED contention (Rik van Riel ) [237677]
- [x86_64] wall time is not compensated for lost timer ticks (Konrad Rzeszutek ) [232666]
- [PPC] handle <.symbol> lookup for kprobes (Scott Moser ) [238465]
- [pci] Dynamic Add and Remove of PCI-E (Konrad Rzeszutek ) [227727]
- [PPC64] Support for ibm,power-off-ups RTAS  call (Scott Moser ) [184681]- [net] Re-enable and update the qla3xxx networking driver (Konrad Rzeszutek ) [225200]
- [misc] xen: kill sys_{lock,unlock} dependency on microcode driver (Gerd Hoffmann ) [219652]
- [acpi] Update ibm_acpi module (Konrad Rzeszutek ) [231176]
- [nfs] NFSv4: referrals support (Steve Dickson ) [230602]
- [misc] random: fix error in entropy extraction (Aristeu Rozanski ) [241718] {k=0-@0-/-1-rnals.hxpointer.hlibxml2.alibxml2.solibxml-2.0.pcxml2Conf.shlibxml.m4libxml2-devel-2.6.26APIchunk0.htmlAPIchunk1.htmlAPIchunk10.htmlAPIchunk11.htmlAPIchunk12.htmlAPIchunk13.htmlAPIchunk14.htmlAPIchunk15.htmlAPIchunk16.htmlAPIchunk17.htmlAPIchunk18.htmlAPIchunk19.htmlAPIchunk2.htmlAPIchunk20.htmlAPIchunk21.htmlAPIchunk22.htmlAPIchunk23.htmlAPIchunk24.htmlAPIchunk25.htmlAPIchunk26.htmlAPIchunk27.htmlAPIchunk28.htmlAPIchunk29.htmlAPIchunk3.htmlAPIchunk4.htmlAPIchunk5.htmlAPIchunk6.htmlAPIchunk7.htmlAPIchunk8.htmlAPIchunk9.htmlAPIconstructors.htmlAPIfiles.htmlAPIfunctions.htmlAPIsymbols.htmlAUTHORSChangeLog.gzCopyrightDOM.gifDOM.htmlFAQ.htmlLibxml2-Logo-180x168.gifLibxml2-Logo-90x34.gifNEWSREADMETODOXMLinfo.htmlXSLT.htmlarchitecture.htmlbugs.htmlcatalog.gifcatalog.htmlcontribs.htmldocs.htmldownloads.htmlencoding.htmlentities.htmlexample.htmlexamplesMakefile.amexamples.xmlexamples.xslindex.pyio1.cio1.resio2.cio2.resparse1.cparse2.cparse3.cparse4.creader1.creader1.resreader2.creader3.creader3.resreader4.creader4.restest1.xmltest2.xmltest3.xmltestWriter.ctree1.ctree1.restree2.ctree2.restst.xmlwriter.xmlxpath1.cxpath1.resxpath2.cxpath2.resguidelines.htmlhelp.htmlhtmlbook1.htmlhome.pngindex.htmlleft.pnglibxml-DOCBparser.htmllibxml-HTMLparser.htmllibxml-HTMLtree.htmllibxml-SAX.htmllibxml-SAX2.htmllibxml-c14n.htmllibxml-catalog.htmllibxml-chvalid.htmllibxml-debugXML.htmllibxml-dict.htmllibxml-encoding.htmllibxml-entities.htmllibxml-globals.htmllibxml-hash.htmllibxml-lib.htmllibxml-list.htmllibxml-nanoftp.htmllibxml-nanohttp.htmllibxml-parser.htmllibxml-parserInternals.htmllibxml-pattern.htmllibxml-relaxng.htmllibxml-schemasInternals.htmllibxml-schematron.htmllibxml-threads.htmllibxml-tree.htmllibxml-uri.htmllibxml-valid.htmllibxml-xinclude.htmllibxml-xlink.htmllibxml-xmlIO.htmllibxml-xmlautomata.htmllibxml-xmlerror.htmllibxml-xmlexports.htmllibxml-xmlmemory.htmllibxml-xmlmodule.htmllibxml-xmlreader.htmllibxml-xmlregexp.htmllibxml-xmlsave.htmllibxml-xmlschemas.htmllibxml-xmlschemastypes.htmllibxml-xmlstring.htmllibxml-xmlunicode.htmllibxml-xmlversion.htmllibxml-xmlwriter.htmllibxml-xpath.htmllibxml-xpathInternals.htmllibxml-xpointer.htmlright.pngup.pngindex.htmlinterface.htmlintro.htmllibrary.htmllibxml.giflibxml2-api.xml.gznamespaces.htmlnews.htmlpython.htmlredhat.gifsearches.htmlsmallfootonly.gifstructure.gifthreads.htmltree.htmltutorialapa.htmlapb.htmlapc.htmlapd.htmlape.htmlapf.htmlapg.htmlaph.htmlapi.htmlar01s02.htmlar01s03.htmlar01s04.htmlar01s05.htmlar01s06.htmlar01s07.htmlar01s08.htmlar01s09.htmlimagesblank.pngcallouts1.png10.png2.png3.png4.png5.png6.png7.png8.png9.pngcaution.pngdraft.pnghome.pngimportant.pngnext.pngnote.pngprev.pngtip.pngtoc-blank.pngtoc-minus.pngtoc-plus.pngup.pngwarning.pngincludeaddattribute.cincludeaddkeyword.cincludeconvert.cincludegetattribute.cincludekeyword.cincludexpath.cindex.htmlix01.htmlxmltutorial.pdfupgrade.htmlw3c.pngxml.htmlxmlcatalog_man.htmlxmldtd.htmlxmlio.htmlxmllint.htmlxmlmem.htmlxmlreader.htmllibxml2general.htmlhome.pngindex.htmlleft.pnglibxml2-DOCBparser.htmllibxml2-HTMLparser.htmllibxml2-HTMLtree.htmllibxml2-SAX.htmllibxml2-SAX2.htmllibxml2-c14n.htmllibxml2-catalog.htmllibxml2-chvalid.htmllibxml2-debugXML.htmllibxml2-dict.htmllibxml2-encoding.htmllibxml2-entities.htmllibxml2-globals.htmllibxml2-hash.htmllibxml2-list.htmllibxml2-nanoftp.htmllibxml2-nanohttp.htmllibxml2-parser.htmllibxml2-parserInternals.htmllibxml2-pattern.htmllibxml2-relaxng.htmllibxml2-schemasInternals.htmllibxml2-schematron.htmllibxml2-threads.htmllibxml2-tree.htmllibxml2-uri.htmllibxml2-valid.htmllibxml2-xinclude.htmllibxml2-xlink.htmllibxml2-xmlIO.htmllibxml2-xmlautomata.htmllibxml2-xmlerror.htmllibxml2-xmlexports.htmllibxml2-xmlmemory.htmllibxml2-xmlmodule.htmllibxml2-xmlreader.htmllibxml2-xmlregexp.htmllibxml2-xmlsj@ fix (Jon Masters)- need to disable all cpu frequency scaling drivers in Xen kernel (Rik van Riel) [210336 208942] 
- radeon hangs DMA when CONFIG_CALGARY_IOMMU is build in kernel. (Konrad Rzeszutek) [210380] 
- Got Call Trace message when remove veth module (Janice Girouard) [208938] 
- cannot generate kABI deps unless kernel is installed (Jon Masters) [203926] 
- ctcmpc driver (Jan Glauber) [184608] 
- PTRACE_DETACH doesn't deliver signals under utrace. (Aristeu S. Rozanski F.) [207674] 
- SG_SCATTER_SZ causing Oops during scsi disk microcode update (Doug Ledford) [207146] 
- ia64 kprobe fixes (David Smith)- Duplicate dput in sysfs_update_file can cause a panic. (Prarit Bhargava) [209454] 
- Lock issue with 2.6.18-1.2702.el5, NetworkManager and ipw3945 (John W. Linville) [208890] 
- cpqarray module fails to detect arrays (Chip Coldwell) [205653] 
- stex.c driver for Promise SuperTrak EX is missing (Jeff Garzik) [209179] 
- NetLabel does not audit configuration changes (Eric Paris) [208456] 
- NetLabel has a race problem in the cache (Eric Paris) [209324] 
- kernel/lockdep.c:1814/trace_hardirqs_on() (Not tainted) for APM (Peter Zijlstra) [209480] 
-  correct netlabel secid for packets without a known label (Eric Paris) [210032] 
- IPSec information leak with labeled networking (Eric Paris) [209171] 
- NetLabel hot-add memory confict pre-beta2 kenrel x86_64 (Konrad Rzeszutek) [208445] 
- NFS data corruption (Steve Dickson) [210071] 
- kernel dm multipath: ioctl support (Alasdair Kergon) [207575] 
- kernel dm: fix alloc_dev error path (Alasdair Kergon) [209660] 
- kernel dm snapshot: fix invalidation ENOMEM (Alasdair Kergon) [209661] 
- kernel dm snapshot: chunk_size parameter is not required after creation (Alasdair Kergon) [209840] 
- kernel dm snapshot: fix metadata error handling (Alasdair Kergon) [209842] 
- kernel dm snapshot: fix metadata writing when suspending (Alasdair Kergon) [209843] 
- kernel dm: full snapshot removal attempt causes a seg fault/kernel bug (Alasdair Kergon) [204796] 
- dm mirror: remove trailing space from table (Alasdair Kergon) [209848] 
- kernel dm: add uevent change event on resume (Alasdair Kergon) [209849] 
- kernel dm crypt: Provide a mechanism to clear key while device suspended (Milan Broz) [185471] 
- kernel dm: use private biosets to avoid deadlock under memory pressure (Alasdair Kergon) [209851] 
- kernel dm: add feature flags to structures for future kABI compatibility (Alasdair Kergon) [208543] 
- kernel dm: application visible I/O errors with dm-multipath and queue_if_no_path when adding new path (Alasdair Kergon) [169302] 
- refresh ia64-kexec-kdump patch (Don Zickus) 
- update exec-shield patch (Don Zickus) 
- revert x86 unwinder fixes (Don Zickus)- update utrace patch to fix s390 build problems
- ia64 hotswap cpu patch fixes to compile under xen
- ia64 export fixes- Audit Filtering on PPID for = and != is inverted (Eric Paris) [206425] 
- Adding Hitachi SANRISE entries into SCSI white list (Chip Coldwell) [206532] 
- forward port of SCSI blacklist from RHEL4 (Chip Coldwell) [208256] 
- Need to add ALSA support for Broadwater platform (John W. Linville) [184855] 
- /proc/<pid>/smaps doesn't give any data (Alexander Viro) [208589] 
- ACPI based CPU hotplug causes kernel panic (Keiichiro Tokunaga) [208487] 
- New infiniband 12x power driver opensourced from IBM (Janice Girouard) [184791] 
- iscsi oops when connection creation fails (Mike Christie) [209006] 
- nommconf work-around still needed for AMD chipsets (Jim Baker) [207396] 
- ProPack XPMEM exported symbols (Greg Edwards) [206215] 
- PCI error recovery bug in e100 and e1000 cards (John W. Linville) [208187] 
- / on raid fails to boot post-install system (Jan Glauber) [196943] 
- auditctl fails to reject malformed ARCH filter (Eric Paris) [206427] 
- oom-killer updates (Larry Woodman) [208583] 
- NFS is revalidating directory entries too often (Steve Dickson) [205454] 
- kernel-xen cannot reboot (Stephen Tweedie) [209841] 
- Unsupported FS's in RHEL 5 Beta 1 (Don Zickus) [206486]- patch fix foOjPx%@in Prabhu) [839753]
- [scsi] remove device put from error return path (Tomas Henzl) [768836]
- [s390] kernel: pfault task state race (Hendrik Brueckner) [831620]
- [s390] zfcpdump: Implement async sdias event processing (Hendrik Brueckner) [818894]
- [s390] kernel: kABI workaround for vDSO support (Hendrik Brueckner) [795895]
- [s390] kernel: Introduce vDSO support (Hendrik Brueckner) [795895]
- [s390] dasd: add hyper PAV support to DASD device driver (Hendrik Brueckner) [795897]- [fs] gfs2: Add kobject release method (Robert S Peterson) [824568]
- [fs] nfsd: safer initialization order in find_file() (Harshula Jayasuriya) [800758]
- [fs] nfsd4: remove use of mutex for file_hashtable (Harshula Jayasuriya) [800758]
- [scsi] bnx2i: Updated version and copyright year (Tomas Henzl) [796827]
- [scsi] bnx2i: fix the bit manipulation when setting error mask (Tomas Henzl) [796827]
- [scsi] bnx2i: Fix NULL ptr ref in conn get param (Tomas Henzl) [796827]
- [scsi] bnx2i: Fixed the override of the error_mask module param (Tomas Henzl) [796827]
- [net] sfc: Private ioctl to allow reset during online fw update (Michal Schmidt) [833600]
- [net] sfc: disable RX hash insertion (Michal Schmidt) [833600]
- [net] sfc: Refill RX rings as soon as space for a batch (Michal Schmidt) [833600]
- [net] sfc: Fill RX rings completely full, rather than to 95% full (Michal Schmidt) [833600]
- [net] sfc: Fix missing cleanup in failure path of efx_pci_probe() (Michal Schmidt) [833600]
- [net] sfc: Do not attempt to flush queues if DMA is disabled (Michal Schmidt) [833600]
- [net] sfc: Remove efx_channel::last_eventq_read_ptr (Michal Schmidt) [833600]
- [net] sfc: Run event/IRQ selftest async at interface bring up (Michal Schmidt) [833600]
- [net] sfc: Encapsulate access to last_irq_cpu in self-test (Michal Schmidt) [833600]
- [net] sfc: Test all event queues in parallel (Michal Schmidt) [833600]
- [net] sfc: Raise self-test timeouts (Michal Schmidt) [833600]
- [net] sfc: Remove TX completions from adaptive IRQ scoring (Michal Schmidt) [833600]
- [net] sfc: Update comments on efx_rx_packet_gro() (Michal Schmidt) [833600]
- [net] sfc: Remove redundant function efx_nic_has_mc() (Michal Schmidt) [833600]
- [net] sfc: Fix assignment of ip_summed for pre-allocated skbs (Michal Schmidt) [833600]
- [net] sfc: Alloc SRAM between caches at init time (Michal Schmidt) [833600]
- [net] sfc: Make all CPU/IRQ/channel/queue counts unsigned (Michal Schmidt) [833600]
- [net] sfc: Make buffer table indices and counts unsigned (Michal Schmidt) [833600]
- [net] sfc: Disable flow control during flushes (Michal Schmidt) [833600]
- [net] sfc: Generalise event gen to cover VF-owned event queues (Michal Schmidt) [833600]
- [net] sfc: Use prop func to test for RX channel in efx_poll (Michal Schmidt) [833600]
- [net] sfc: Leave interrupts/event queues enabled whenever we can (Michal Schmidt) [833600]
- [net] sfc: Generate RX fill events based on RX queues (Michal Schmidt) [833600]
- [net] sfc: Generalise driver event generation (Michal Schmidt) [833600]
- [net] sfc: Correct MAC filter bitfield definitions (Michal Schmidt) [833600]
- [net] sfc: Warn if unable to create MTDs (Michal Schmidt) [833600]
- [net] sfc: Replace some constants with EFX_PAGE_SIZE/EFX_BUF_SIZE (Michal Schmidt) [833600]
- [net] sfc: Do not retry hardware probe if it schedules a reset (Michal Schmidt) [833600]
- [net] sfc: Skip RX end-of-batch work on channels w/o an RX queue (Michal Schmidt) [833600]
- [net] sfc: Use a more sensible cast in efx_rx_buf_offset() (Michal Schmidt) [833600]
- [net] sfc: Replace is_page and other booleans with a flags field (Michal Schmidt) [833600]
- [net] sfc: Move end of non-GRO RX path into its own function (Michal Schmidt) [833600]
- [net] sfc: Make all MAC statistics consistently 64 bits wide (Michal Schmidt) [833600]
- [net] sfc: Remove redundant 'rc' variable, always set to 0 (Michal Schmidt) [833600]
- [net] sfc: Minor formatting fixes (Michal Schmidt) [833600]
- [net] sfc: Use local variables not repeated indirect lookups (Michal Schmidt) [833600k`#,@,+,Nalin Dahyabhai <nalin@redhat.com> 0.49.102-1Nalin Dahyabhai <nalin@redhat.com> 0.49.101-3Nalin Dahyabhai <nalin@redhat.com> 0.49.101-2Nalin Dahyabhai <nalin@redhat.com> 0.49.101-1Nalin Dahyabhai <nalin@redhat.com> 0.49.100-1Nalin Dahyabhai <nalin@redhat.com> 0.49.99-1Nalin Dahyabhai <nalin@redhat.com> 0.49.98-1Nalin Dahyabhai <nalin@redhat.com> 0.49.97-1Nalin Dahyabhai <nalin@redhat.com> 0.49.96-1Nalin Dahyabhai <nalin@redhat.com> 0.49.95-1Nalin Dahyabhai <nalin@redhat.com> 0.49.94-2Nalin Dahyabhai <nalin@redhat.com> 0.49.93-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.49.92-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.49.91-1Nalin Dahyabhai <nalin@redhat.com> 0.49.90-1Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.32-1Nalin Dahyabhai <nalin@redhat.com> 0.31-1Nalin Dahyabhai <nalin@redhat.com> 0.30-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.29-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.28-1Nalin Dahyabhai <nalin@redhat.com> 0.27-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.26-1Nalin Dahyabhai <nalin@redhat.com> 0.25.1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.25-1Nalin Dahyabhai <nalin@redhat.com> 0.24-4Nalin Dahyabhai <nalin@redhat.com> 0.24-3Nalin Dahyabhai <nalin@redhat.com> 0.23-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.21-1Nalin Dahyabhai <nalin@redhat.com> Nalin Dahyabhai <nalin@redhat.com> 0.20-1Nalin Dahyabhai <nalin@redhat.com> 0.18-1Nalin Dahyabhai <nalin@redhat.com> 0.16.1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.11Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.10Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.9Nalin Dahyabhai <nalin@redhat.com> 0.8.2Nalin Dahyabhai <nalin@redhat.com> 0.8.1Nalin Dahyabhai <nalin@redhat.com> 0.8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.7Nalin Dahyabhai <nalin@redhat.com> 0.6- Default commonName to user name if gecos is empty
  Resolves: #670279
- Fix segfault when reading database files with certain sizes
  Resolves: #758117- Correctly mark the LDAP default password value as encrypted (CVE-2011-0002)
  Resolves: #668019- Change Release: to add space for Z-stream
  Related: #506628- Fix nscd cache invalidation
  Resolves: #506628- Make tests/pwhash_test executable
  R_esolves: #439209- Fix man page typos and copy&paste errors
  Resolves: #434946, #434948- Add support for SHA256 and SHA512 in password hashes
  Resolves: #427795- When changing passwords, only silently ignore known shadow markers, not all
  invalid hashes
  Resolves: #225495
- Update the last password change date field when changing passwords
  Resolves: #243854- Allow specifying a SASL mechanism (original patch by Simo Sorce)
  Resolves: #244231- Backport translations from CVS
  Resolves: #216619- rebuilt for unwind info generation, broken in gcc-4.1.1-21- New release with updated translations- rebuild- Configure without --enable-gtk-doc to fix multilib conflict (#192715)- Fix bugs in handling of invalid lines in the files and shadow modules
- Fix pattern matching in lu_*_enumerate_full in the files and shadow modules
- Add more error reporting, return non-zero exit status on error from utils
- Use the skek`'@trootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrooi00@	m>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkraenzer <bero@redhat.com> 1.23-5Bernhard Rosenkraenzer <bero@redhat.com> 1.23-4Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Than Ngo <than@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Alan Eldridge <alane@geeksrus.net>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Helge Deller <hdeller@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Jakub Jelinek <jakub@redhat.com>Prospector <bugzilla@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Elliot Lee <sopwith@redhat.com>Jakub Jelinek <jakub@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson  <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Fix uuidd permissions (#905027)
- Better handle errors in journal superblock during e2fsck (#885073)
- Ensure chattr errors out on symbolic links (#910214)- Fix use after free in libblkid's blkid_set_tag (#922567)- Fix 16T boundary conditions in resize2fs (#701776)- uuidd: Fix pid file so it has the correct pid number (#707433)- Fix free of uninitialized pointer in blkid (#696930)- Fix e2fsck pass 2 "should never happen" case (#681071)
- Safe variant of uuid_generate_time() and fix locking (#678304)- Don't dup xattr blocks during fsck if fs is lacking xattr support (#562044)- Handle more than 128 devices on blkid cmdline (#675694)- Leave resize inode intact whet growing to 16T (#491385)- Fix libcom_err sign extension bug (#579836)
- Add blkid garbage collection (#563909)
- Fix fsck return code (#618134)
- Fix chattr/lsattr return code (#606757)- lsattr should return ENOENT if no file exists (#489842)
- blkid: fix whole-device scanning heuristics (#506643)
- blkid: dm/multipath scanning fixes (#553216)
- fix various floating point precision errors (#607843)- fix build with new gettext (#669676)
- mke2fs etc: Use floating point to calculate percentages (#587778)- blkid: handle stale entries in blkid cache (#637920)- e2fsck: mark sparse journal as invalid (#580671)- Fix up several issues from code inspection (#505110)
- Fix typo in uuidd initscript (#506080)- Handle filesystems between 8T and 16T more gracefully (#241285)- Fix typo in de localization file (#488960)- Add blkid support for LUKS encrypted partitions (#464787)- Fix type-punning warning stemming from alias violation fix (#438356)- Fix aliasing violation causing dumpe2fs segfaults in ia64 (#438356)- Fix potential (but rare) data corruption on log replay (#450765)- Teach blkid to recognize ext4 and ext4dev (#448013)- Add missing part of fix for e2fsck journal recovery (#241222)- Fix up TLS test,j 
@
+
135aefebb1a2b44790124df6fc53075cf3aa043d070c4f651fb870e50b27b60b5193d482ab34520f76b82e61194677b1ed82e408f03a79ef4af91d9c7caba24617f7179d1874c5c4ef2121801d22c01a1fc86f1879c36e30bb65474f934cdbda48bc01931097ea04555362cf1cedd19df49ab390d48d144aeb9208e7d0bf24f1cc230357f0113d34045eec0ed1962a09bdeb349af71fba3df3bc68d0b6d24207a792e78f217cae9f97959a1e4972f0550a1d4a9c586c78eb5a4c87b09a0f78d3947c5dc839c9ca7a013b2982dca806b46e6ec81db6654bb4122683f72ceeab691907e64786760cb99fcd0e0cc04dca200d22e9a406446160ccc4012ee1ed52271b5cac393249ee50cb2331ed7ff6064d7561cf87a88bc532e8dbffbf7ae0c2ec78d5bac13802dd1c8cc674a21ead3ff773e2b93b1b96a06a8049e0a49ae384f939e85e4b8bf05607b784da600adc6a9dd2cd0fbee2d2dabbe25758a4070bb8c69b3e1322a531e6343df2044a790470acb02a1263fa78a94d7939cd88d4c33511c4292ecec5926e819de674856840f41280842e18f1e295958332eff69c658ddb37612fac9ac6ff18841a252dc03a3d4dedbb0cdedc6c5ae9a143a7a21769c1755cc96f1d4b7f618987bf44eaf60a48398045ec0c05d885b2afdeaf2280fe94a03dccc653447becc1db1526b27defd768155a22ca7fb479a2934f8c618398e7e993b22aed725e1380c501d7066010db8fc1b2d353787e60d8282dd89c8dd8ccaee5ef21f568456a2c75870af58cbdacd66f56031046bc7063406f69cee0aaacb72b323b89c8649748e6465961329282f04b8f4f9e496acb82048c03217bd19e77fdad9fa2fcfb40db564357bb2b058901f5e94496753dd87bef7877f0004a48c33191d6e437f98f0ed26c41e5391fe13a93424869d4101d09a6ee3160f81f34df1e220729e2a865e338df22e6a2697349d7c61c769459952eded445ff4caf1b5cd457f839251692cf2b32a37737e185bc1ee21760dd3283e086e91091ccb8980f5cd068130a72c85877cc941521a9a25ed79a59b69b3f0335c8e7d6fad16c76c6a06afe816a0ab5222235d40cbedb170d27986f255a4e1b73b9033b3057632d12cf21e61ac1fd67bfc0b9cffac95089264f7236d502a54aa3251dc083dd6507126354affe07212e71e3a0d86a11f8fac90cdb56785f31c572b2bb94a82eb2035769931c7d61dfeef4eb074500048ee27044e13ef8c8c2c238104f5897e389f1adfd7292e867b74c4a218383cf0ffdfc7366f53761050d42ca4e2268877e5e98d5eb04ca239af67203754d7d37f88960f958bc954ac3a652202da26f5b3ec86efd6c45fb124750ff1c5b994664b87ac63316da85b9d17ee5a8561369725f3d727df1f771b0e66312efdc31a1258e3bf3c6a2c44b3fb3d3f81e63f4e2aec1c96eb17f017f2666f36fd8003683eaebd22000ef341eb15f7d1e04d5d52553b7c63d1a158b43ca2807b81e440adc646437f701be06fb185b8accbdd1bbbf6432531b88b821a633bbe5a665ede08fa200b9a2b95e819fa51ea200c1d8edd6b182f1076a84fb5d4133e2c9d403faa6f313e9fa6a61d91cb9351af8c83a813d0cfcaf579edbc67ae6d25988b58e71120419f568ea0564529ad0bd64d0e62c940903ce9c0ee2b60c27dc727e8c36d2558254175d9c1717a042e99fb2577792cb310ed63e6ef1e76e2f110554e53656b5a584dac7ea97f1c825eb22442e33bd709cb6b69a2e27a49d388cdfdae313a258e389faa39f2dc04bb56e47328f92564e082affa4c425a79fab16986fc0f4e855b72a71b92d0686efba68ff0a99be0d0e400ee27f832c012c840d4354a0a67ef7b581b94ea32faab295e31b227ec349905657646f0e9396868c56c35e798627f5e0dac49dbd6ab86669030526632d04d85a33bd3837d3b8cee2d07fd79b84738405026cea5fe53167dda98791c2b2d0fe36f3d45be32bf6b4bc488e2ea09e4fae0dd58666f503de3d78f260323df1b6f5f6ef38fbe12a7af53f764777e5330c878a1dfe0aeb02bdd5905c2d0db8228f2e4232da25624c9f6b4f0a00a728ab4908b084fa5045910857f09af87c5cf9c0ef0f5033ff3c0a4a2884868811abf7a5277197aca168ca9c8e357aacb6a1eb6ece1a8f78df21e39b521a56f54e8bff156f24d310aac30b30e788be4fe32c05567c80888eba7c53caf0e83990816ba25ce65fe752107092e518d72fa93299e973f70cf0cd57763e305c10b084b4c732b50adb6e96e1412df90752bf053603bc5f5fc7cb97b8c76dd80eb3dbe1c32514d8652493524da0b99bd45bfe5d17103e7733ec1415e3ebee6e63ca4cf78059b770eca97d6533443fcb642959615a6a662f482c2fbf26b30324e6feb0405c02776bf09e0149a2018cb52ac3426058c8c32381541ae9bcb160039601f69551f282812a9b9d1203816f5c6828cd245e7376056d3b2f2fba8cda83e28887dbfba2e9caf1fc8adfcfb0f7120896417aa7d14d34bd37500e5d05999047d88ae3632653a474d998197dc2ecc180f7ce8f41b85491b634adf9dcaf4650d52be3b8f565a5b4f901cfb9ac16c6f0fa2b4db78162c5775e78d6f7e9275bee1de98708431838bef21892efc55a2345f61a1724931692e3da01cd355065449527ad8a7002a9445eb9db27a6b7dd0f6db05bd30023988a8eaebf8c3948a91361f85ec7e090eeffe9d6927903a83db53004d395102bd32fad884db9dd55debc64dc5dc1c24eb230de479b7317548ef5fe8fj=ȼ@r RDSCTP (Don Zickus)- RDTSCP Support (Bhavana Nagendra) [185057] 
- s390 kprobe on larl instruction crashes system (Jan Glauber) [205738] 
- single stepping is broken when kprobes is configured (Jan Glauber) [205739] 
- autofs kernel patches resulting from Connectathon testing (Ian Kent) [206952] 
- Include the qla3xxx networking driver (Konrad Rzeszutek) [208182] 
- overzealous sanity checking in sys_poll() (Chris Snook) [204705] 
- automounter cannot shutdown when timeout=0 (Ian Kent) [205836] 
- Rewrite of journaling data commit code (Eric Sandeen) [207739] 
- qla4xxx soft lockup when ethernet cable disconnected (Mike Christie) [206063] 
- hypfs_kill_super() check for initialized root inode (Jan Glauber) [207717] 
- The Matrox graphics driver is not built (Janice Girouard) [207200]- Wrong SELinux context prevents hidd from working (David Woodhouse) [204655] 
- nfs connectathon component basic test 6 fails.... (Steve Dickson) [208637] 
- unstick STICKY bit to fix suspend/resume (Dave Jones)- fix up ipv6 multiple routing table patch- s390 ccs/ccw subsystem does not have proper uevent support (Pete Zaitcev) [199994] 
- 'Cannot allocate memory' when cat /proc/scsi/scsi (Chip Coldwell) [200299] 
- Add support for Kirkwood and Kirkwood LP NICs (John W. Linville) [207776] 
- remove userspace support from qla4xxx (Mike Christie) [206063] 
- NetLabel interface has changed in the upstream kernels (Eric Paris) [208119] 
- lockdep fixes (Peter Zijlstra) [208304 204795]- Updated GFS2/DLM patch-Multiple routing tables for IPv6 (Thomas Graf) [179612] 
-bunch of lockdep fixes (Peter Zijlstra) [200520 208294 208293 208292 208290] 
-rearrange the cachefs patches for easier future maintance (Steve Dickson) 
-enable some TCP congestion algorithms (David Miller) 
-add a test patch (Eric Paris)- Need to add the sata sas bits-Native SAS and SATA device support - SATA/IDE converter (Janice Girouard) [196336] 
-kernel unaligned access messages in rhel5a1 (Prarit Bhargava) [198572] 
-problems with LUNs mapped at LUN0 with iscsi and netapp filers (Mike Christie) [205802] 
-ext3 fails to mount a 16T filesystem due to overflows (Eric Sandeen) [206721] 
-possible recursive locking detected - swapper/1 (Peter Zijlstra) [203098] 
-FS-Cache: error from cache: -28 (David Howells) [204614] 
-aic94xx driver does not recognise SAS drives in x366 (Konrad Rzeszutek) [206526] 
-Support for 3945 driver (John W. Linville) [195534] 
-Memory Hotplug fails due to relocatable kernel patches (Vivek Goyal) [207596] 
-Potential overflow in jbd for filesystems > 8T (Eric Sandeen) [208024] 
-2,4-node x460 halts during bootup after installation (Konrad Rzeszutek) [203971]- fix x86 relocatable patch (again) to build properly- Disable 31bit s390 kernel builds.- Make kernel packages own initrd files- Add periodic work fix for bcm43xx driver- Disable dgrs driver.- Fix PowerPC audit syscall success/failure check (#204927)
- Remove offsetof() from <linux/stddef.h> (#207569)
- One line per header in Kbuild files to reduce conflicts
- Fix visibility of ptrace operations on ppc32
- Fix ppc32 SECCOMP- reiserfs: make sure all dentry refs are released before
  calling kill_block_super
- Fix up some compile warnings- clean up spec file.- drop 2.6.18-rc iscsi patch for rebase- xen HV printf rate limit (rostedt).
- xen HV update to xen-unstable cset11540:9837ff37e354
- xen-update:
  * linux-2.6 changeset:   34294:dc1d277d06e0
  * linux-2.6-xen-fedora changeset:   36184:47c098fdce14
  * xen-unstable changeset:   11540:9837ff37e354- 2.6.18
- i965 AGP suspend support.
- AGP x8 fixes.- xen update to 2.6.18-rc7-git4.
  * linux-2.6 changeset: 34288:3fa5ab23fee7
  * linux-2.6-xen-fedora changeset: 36175:275f8c0b6342
  * xen-unstable changeset: 11486:d8bceca5f07d- 2.6.18rc7-git4
- Further lockdep fixes. (#207064)- EXT3 overflows at 16TB (#206721)- Increase nodes supported on ia64 (#203184)
- Powernow K8 Clock fix (#204354)
- NetLabel fixes- Fix RTC lockdep bug. (Peter Zijlstra)- xen HV update (cset 11470:2b8dc69744e3).- Fix various Bluetook'ȷ-@---mail.cw  | \
      awk 'BEGIN { print "# Entries from obsoleted /etc/sendmail.cw" ;} \
           { print $1 }' >> /etc/mail/local-host-names
    cp /etc/sendmail.cw /etc/sendmail.cw.rpmorig
fi
#
# Rebuild maps (next reboot will rebuild also)
#
{
  chown root /etc/aliases.db /etc/mail/access.db /etc/mail/mailertable.db \
    /etc/mail/domaintable.db  /etc/mail/virtusertable.db
  /usr/bin/newaliases
  for map in virtusertable access domaintable mailertable ; do
    if [ -f /etc/mail/${map} ]; then
      /usr/bin/makemap hash /etc/mail/${map} < /etc/mail/${map}
    fi
  done
} > /dev/null 2>&1if [ $1 = 0 ]; then
	/etc/rc.d/init.d/sendmail stop >/dev/null 2>&1
	/sbin/chkconfig --del sendmail
	/usr/sbin/alternatives --remove mta /usr/sbin/sendmail.sendmail
fi
exit 0if [ "$1" -ge "1" ]; then
	/etc/rc.d/init.d/sendmail condrestart >/dev/null 2>&1
	mta=`readlink /etc/alternatives/mta`
	if [ "$mta" == "/usr/sbin/sendmail.sendmail" ]; then
		/usr/sbin/alternatives --set mta /usr/sbin/sendmail.sendmail
	fi
fi
exit 00c00@0%0H
)x)0jZxX
(M'yXA큤$A큤mmA큀AAUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUebfc06e19d6678cf17ff6a1a0d7ec888a5d51b317cd3860ced4453d30d21712b4e92d74de6a8bb97e9cf9d9ef8e6d5e67ba67f0ef6e9b011185b3870d3d19cfbd41d8cd98f00b204e9800998ecf8427eb70f7921029c159bf8cf2e95435478a336d4eb04f7ae4c6ff162205c8c34e03bb116a8178f3c5fccdfbfd6749b3390a0d41d8cd98f00b204e9800998ecf8427ef52a12c8a1cd76448ecefc39424a3d2734093bfc133db8d034466cfaa426a00f74a037d5408372460fb723eb4734d2ed3be5f710ea9b7130e4b7b4a394ccd8a7225cf1ac7d34b2446669934cf4410dc2af474e4b5ef338bbc4080568320c8d6ad41d8cd98f00b204e9800998ecf8427e27d43cf065e74e9f503d062785712a42f16bbd4bef21bd9021303f15590e54527813dc47284e3b398396552a9dd2e7add8db24710c2812b0da3066f2ea7cab91ddb41ba6234c80fde094b4a43d0b491a94e0f905ba70eeab33ba242cd9fcc30f0bb5c04390237e1c372abc4db1cb421d2f9b7a93df6012a45f25228b5cca903148c0a35d2d4793eec9a98608c9a9846547c2064c1ee011b8b63da600a722fed587f997a889f8f3073ee41b1898614b5171a79e4e9a194d4f53b8c70014f1a9304d46ae34f6ee17d9288521607e4f52cd17a7a369fbf077dc05f1bcc4f7a9b5008299f7439848aad68857ba1098267ab8a0456a11510b12dd86d16e0516ae4af52ab3dbb8ac692da1da9ac851936c8886e6d62aa07ff694fe8e257c316b0543ad81f19c3dde032ce50e32332d837c39a85c80cf37cd8afc8fac56f228ce30e4a8d41d8cd98f00b204e9800998ecf8427e../../usr/sbin/sendmail../../usr/sbin/sendmail../../usr/sbin/makemap../../usr/sbin/sendmail../../usr/sbin/sendmail../sbin/sendmail@@@@@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsmmsprootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsmmsprootrootrootrootrootrootrootrootrootrootrootrootsmmspmailsendmail-8.13.8-10.el5_11.src.rpm/usr/bin/mailq/usr/bin/newaliases/usr/bin/rmail/usr/sbin/sendmail/usr/share/man/man1/mailq.1.gz/usr/share/man/man1/newaliases.1.gz/usr/share/man/mjH@ICT (Frantisek Hrbata) [653250]
- [misc] kernel: restrict unprivileged access to dmesg (Frantisek Hrbata) [653250]
- [virt] xen: don't allow blkback virtual CDROM device (Andrew Jones) [635638] {CVE-2010-4238}
- Revert: [xen] cd-rom drive does not recognize new media (Andrew Jones) [635638] {CVE-2010-4238}
- [net] qlge: fix deadlock when interface is going down (Chad Dupuis) [654420]
- [net] qlge: reset chip before freeing buffers (Chad Dupuis) [654420]
- [net] qlge: restore vlan setting during ql_adapter_up (Chad Dupuis) [654420]
- [scsi] qla4xxx: Update version to V5.02.04.00.05.06-d0 (Chad Dupuis) [656999]
- [scsi] qla4xxx: Document Driver Versioning Scheme (Chad Dupuis) [656999]
- [scsi] qla4xxx: Updated the Copyright header to 2010 (Chad Dupuis) [656999]
- [scsi] qla4xxx: don't process devices untill probe done (Chad Dupuis) [656999]
- [scsi] qla4xxx: free DDB when application calls for it (Chad Dupuis) [656999]
- [scsi] qla4xxx: memory wedge with peg_halt test in loop (Chad Dupuis) [656999]
- [scsi] qla4xxx: clear AF_FW_RECOVERY flag after reset (Chad Dupuis) [656999]
- [scsi] qla4xxx: fix new IP address caching (Chad Dupuis) [656999]
- [scsi] qla4xxx: replace hard coded values with macros (Chad Dupuis) [656999]
- [scsi] qla4xxx: mark dev FAILED on 82XX init failure (Chad Dupuis) [656999]
- [scsi] qla4xxx: fail init if pci mem write fails (Chad Dupuis) [656999]
- [scsi] qla4xxx: ensure proper qla4xxx_conn_start state (Chad Dupuis) [656999]
- [scsi] qla4xxx: do not process interrupts unconditionally (Chad Dupuis) [656999]
- [scsi] qla4xxx: fix add w/iscsi2_create_conn not done yet (Chad Dupuis) [656999]
- [scsi] qla4xxx: no fw hung if reset retry is in progress (Chad Dupuis) [656999]
- [scsi] qla4xxx: correct use of cmd->host_scribble (Chad Dupuis) [656999]
- [scsi] qla4xxx: msi init request_irq parameter usage fix (Chad Dupuis) [656999]
- [scsi] qla4xxx: cleanup qla4xxx_wait_for_hba_online (Chad Dupuis) [656999]
- [scsi] qla4xxx: grab hardware_lock before accessing srb (Chad Dupuis) [656999]
- [scsi] qla4xxx: remove unwanted check for bad spd (Chad Dupuis) [656999]
- [scsi] qla4xxx: update AER support for ISP82XX (Chad Dupuis) [656999]
- [scsi] qla4xxx: clear rom lock if firmware died holding (Chad Dupuis) [656999]
- [scsi] qla4xxx: CRB Register for Request Queue in-pointer (Chad Dupuis) [656999]
- [scsi] qla4xxx: dump mailbox registers on System Error (Chad Dupuis) [656999]
- [scsi] qla4xxx: add support for 8130/8131 AENs (Chad Dupuis) [656999]
- [scsi] qla4xxx: fix seconds_since_last_heartbeat reset (Chad Dupuis) [656999]
- [scsi] qla4xxx: no wait for outstanding command complete (Chad Dupuis) [656999]
- [scsi] qla4xxx: free_irqs on failed initialize_adapter (Chad Dupuis) [656999]
- [virt] xen: fix netback hotplug regression in xenbus fix (Laszlo Ersek) [635999]
- [xen] fix 64-bit PV guest user mode segv crashing host (Paolo Bonzini) [658354] {CVE-2010-4255}- [net] filter: fix backport error in prior filter fix (Jarod Wilson) [651703]- [s390] vmlogrdr: purge after recording is switched off (Hendrik Brueckner) [653479]
- [wireless] ieee80211: fix deauthentication (Stanislaw Gruszka) [644367]
- [wireless] zd1211rw: fix associate after disassociate (Stanislaw Gruszka) [644367]
- [fs] proc: fix NULL ->i_fop oops (Steve Best) [655083]
- [scsi] lpfc: Update version to 8.2.0.87.1p (Rob Evers) [655119]
- [scsi] lpfc: set heartbeat timer off by default (Rob Evers) [655119]
- [scsi] lpfc: fix NULL deref duing allocation failure (Rob Evers) [655119]
- [scsi] lpfc: fix remote SLI4 firmware download data bug (Rob Evers) [655119]
- [scsi] lpfc: fix FDMI_DID login failure after link bounce (Rob Evers) [655119]
- [scsi] lpfc: handle CVL after nameserver PLOGI timeouts (Rob Evers) [655119]
- [scsi] lpfc: cleanup mbox cmds in mboxq_cmpl if CVL rcvd (Rob Evers) [655119]
- [misc] posix-cpu-timers: workaround for mt exec problems (Oleg Nesterov) [656266]
- [fs] setup_arg_pages: diagnose excessive argument size (Oleg Nesterov) [645227]
- [net] bnx2x: force interrupt mode for iscsi unset mac (Michal Schmidt)ke@ce.hsembuf.hsetup.hshmbuf.hshmparam.hsigcontext.hsigcontext32.hsiginfo.hsignal.hsocket.hsockios.hstat.hstatfs.htermbits.htermios.htypes.hucontext.hunistd.huser.hvsyscall.hvsyscall32.ha.out.hauxvec.hboot.hbootsetup.hbyteorder.hcpufeature.hdebugreg.helf.herrno.hfcntl.hioctl.hioctls.hipcbuf.hldt.hmce.hmman.hmsgbuf.hmsr.hmtrr.hpage.hparam.hpoll.hposix_types.hprctl.hptrace.hresource.hsembuf.hsetup.hshmbuf.hshmparam.hsigcontext.hsigcontext32.hsiginfo.hsignal.hsocket.hsockios.hstat.hstatfs.htermbits.htermios.htypes.hucontext.hunistd.huser.hvm86.hvsyscall.hvsyscall32.hlinuxa.out.hacct.hadb.hadfs_fs.haffs_fs.haffs_hardblocks.hagpgart.haio_abi.hapm_bios.harcfb.hatalk.hatm.hatm_eni.hatm_he.hatm_idt77105.hatm_nicstar.hatm_tcp.hatm_zatm.hatmapi.hatmarp.hatmbr2684.hatmclip.hatmdev.hatmioc.hatmlec.hatmmpc.hatmppp.hatmsap.hatmsvc.haudit.hauto_fs.hauto_fs4.hauxvec.hawe_voice.hax25.hb1lli.hbaycom.hbfs_fs.hbinfmts.hblkpg.hbpqether.hbyteorderbig_endian.hgeneric.hlittle_endian.hpdp_endian.hswab.hswabb.hcapability.hcapi.hcciss_defs.hcciss_ioctl.hcdk.hcdrom.hchio.hcm4000_cs.hcn_proc.hcoda.hcoda_psdev.hcoff.hcomstats.hconnector.hconsolemap.hcramfs_fs.hcuda.hcyclades.hcycx_cfm.hdccp.hdirent.hdivert.hdlm.hdlm_device.hdlm_netlink.hdlm_plock.hdm-ioctl.hdn.hdqblk_v1.hdqblk_v2.hdqblk_xfs.hdvbaudio.hca.hdmx.hfrontend.hnet.hosd.hversion.hvideo.hefs_fs_sb.helf-em.helf-fdpic.helf.helfcore.herrno.herrqueue.hethtool.heventpoll.hext2_fs.hext3_fs.hfadvise.hfalloc.hfb.hfcntl.hfd.hfdreg.hfiemap.hfilter.hfirewire-cdev.hfirewire-constants.hflat.hfs.hftape-header-segment.hftape-vendors.hftape.hfuse.hfutex.hgameport.hgen_stats.hgeneric_serial.hgenetlink.hgenhd.hgfs2_ondisk.hgigaset_dev.hhayesesp.hhdlchdlc.hioctl.hhdlcdrv.hhdreg.hhdsmart.hhid.hhiddev.hhidraw.hhpet.hhpfs_fs.hhysdn_if.hi2c-dev.hi2c.hi2o-dev.hi8k.hicmp.hicmpv6.hif.hif_addr.hif_arcnet.hif_arp.hif_bonding.hif_bridge.hif_cablemodem.hif_ec.hif_eql.hif_ether.hif_fc.hif_fddi.hif_frad.hif_hippi.hif_infiniband.hif_ltalk.hif_packet.hif_plip.hif_ppp.hif_pppox.hif_shaper.hif_slip.hif_strip.hif_tr.hif_tun.hif_tunnel.hif_vlan.hif_wanpipe.higmp.hin.hin6.hin_route.hinet_diag.hinotify.hinput.hioctl.hip.hip_mp_alg.hipc.hipmi.hipmi_msgdefs.hipsec.hipv6.hipv6_route.hipx.hirda.hisdnisdn.hcapicmd.hisdn_divertif.hisdn_ppp.hisdnif.hisicom.hiso_fs.hite_gpio.hixjuser.hjbd.hjffs2.hjoystick.hkd.hkdev_t.hkernel.hkernelcapi.hkeyboard.hkeyctl.hlimits.hllc.hlock_dlm_plock.hloop.hlp.hmajor.hmatroxfb.hmempolicy.hmeye.hmii.hminix_fs.hmman.hmmtimer.hmqueue.hmroute.hmsdos_fs.hmsg.hmtio.hn_r3964.hnbd.hncp.hncp_fs.hncp_mount.hncp_no.hnet.hnet_dropmon.hnetdevice.hnetfilternetfilter.hnf_conntrack_common.hnf_conntrack_ftp.hnf_conntrack_sctp.hnf_conntrack_tcp.hnf_conntrack_tuple_common.hnfnetlink.hnfnetlink_conntrack.hnfnetlink_log.hnfnetlink_queue.hx_tables.hxt_CLASSIFY.hxt_CONNMARK.hxt_CONNSECMARK.hxt_DSCP.hxt_MARK.hxt_NFQUEUE.hxt_SECMARK.hxt_comment.hxt_connbytes.hxt_connmark.hxt_conntrack.hxt_dccp.hxt_dscp.hxt_esp.hxt_helper.hxt_length.hxt_limit.hxt_mac.hxt_mark.hxt_multiport.hxt_physdev.hxt_pkttype.hxt_policy.hxt_realm.hxt_sctp.hxt_state.hxt_string.hxt_tcpmss.hxt_tcpudp.hnetfilter_arpnetfilter_arp.harp_tables.harpt_mangle.hnetfilter_bridgenetfilter_bridge.hebt_802_3.hebt_among.hebt_arp.hebt_arpreply.hebt_ip.hebt_limit.hebt_log.hebt_mark_m.hebt_mark_t.hebt_nat.hebt_pkttype.hebt_redirect.hebt_stp.hebt_ulog.hebt_vlan.hebtables.hnetfilter_decnet.hnetfilter_ipv4netfilter_ipv4.hip_conntrack.hip_conntrack_h323.hip_conntrack_helper.hip_conntrack_helper_h323_asn1.hip_conntrack_helper_h323_types.hip_conntrack_irc.hip_conntrack_pptp.hip_conntrack_proto_gre.hip_conntrack_protocol.hip_conntrack_sctp.hip_conntrack_tcp.hip_conntrack_tftp.hip_conntrack_tk`!0-@--Q?d		F<@X\el	uU
%
00	0
P000
0T0E07\0+++()	*J+\,p-x89":E7=>?@DFG0H0I0XY\0]0^!bdmerfwkylt0uX0vwp0x00yd{0AA
V0ghCsendmail8.13.810.el5_11A widely used Mail Transport Agent (MTA).The Sendmail program is a very widely used Mail Transport Agent (MTA).
MTAs send mail from one machine to another. Sendmail is not a client
program, which you use to read your email. Sendmail is a
behind-the-scenes program which actually moves your email over
networks or the Internet to where you want it to go.

If you ever need to reconfigure Sendmail, you will also need to have
the sendmail.cf package installed. If you need documentation on
Sendmail, you can install the sendmail-doc package.Ubuilder17.centos.orgCentOS-5CentOSSendmailSystem Environment/Daemonslinuxx86_64/usr/sbin/useradd -u 47 -d /var/spool/mqueue -r -s /sbin/nologin mailnull >/dev/null 2>&1
/usr/sbin/useradd -u 51 -d /var/spool/mqueue -r -s /sbin/nologin smmsp >/dev/null 2>&1
exit 0#
# Convert old format to new
#
if [ -f /etc/mail/deny ] ; then
    cat /etc/mail/deny | \
	awk 'BEGIN{ print "# Entries from obsoleted /etc/mail/deny"} \
		  {print $1" REJECT"}' >> /etc/mail/access
    cp /etc/mail/deny /etc/mail/deny.rpmorig
fi
for oldfile in relay_allow ip_allow name_allow ; do
    if [ -f /etc/mail/$oldfile ] ; then
	cat /etc/mail/$oldfile | \
		awk "BEGIN { print \"# Entries from obsoleted /etc/mail/$oldfile\" ;} \
	     { print \$1\" RELAY\" }" >> /etc/mail/access
	cp /etc/mail/$oldfile /etc/mail/$oldfile.rpmorig
     fi
done

#
# Remove deprecated config flags which are probably harmless to remove
#
cf=`/bin/mktemp /etc/mail/sendmail.cf.XXXXXX`
if [ "$cf" != "" ] ; then
	sed 's/^O AutoRebuildAliases$/#&/g' /etc/mail/sendmail.cf > ${cf} && \
	touch -r /etc/mail/sendmail.cf ${cf}
	cat ${cf} > /etc/mail/sendmail.cf
	touch -r ${cf} /etc/mail/sendmail.cf
	rm ${cf}
fi

/sbin/chkconfig --add sendmail
#
# Set up the alternatives files for MTAs.
#
/usr/sbin/alternatives --install /usr/sbin/sendmail mta /usr/sbin/sendmail.sendmail 90 \
	--slave /usr/bin/mailq mta-mailq /usr/bin/mailq.sendmail \
	--slave /usr/bin/newaliases mta-newaliases /usr/bin/newaliases.sendmail \
	--slave /usr/bin/rmail mta-rmail /usr/bin/rmail.sendmail \
	--slave /usr/lib/sendmail mta-sendmail /usr/lib/sendmail.sendmail \
        --slave /etc/pam.d/smtp mta-pam /etc/pam.d/smtp.sendmail \
	--slave /usr/share/man/man8/sendmail.8.gz mta-sendmailman /usr/share/man/man8/sendmail.sendmail.8.gz \
	--slave /usr/share/man/man1/mailq.1.gz mta-mailqman /usr/share/man/man1/mailq.sendmail.1.gz \
	--slave /usr/share/man/man1/newaliases.1.gz mta-newaliasesman /usr/share/man/man1/newaliases.sendmail.1.gz \
	--slave /usr/share/man/man5/aliases.5.gz mta-aliasesman /usr/share/man/man5/aliases.sendmail.5.gz \
	--initscript sendmail


#
# Oops, these files moved
#
if [ -f /etc/sendmail.cw ]; then
    cat /etc/send;k`@6l.com> for ldapsam_compat
  These two patches close bugzilla #132169- Upgrade to 3.0.7, which fixes CAN-2004-0807 CAN-2004-0808
  This obsoletes the 3.0.6-schema patch.
- Update BuildRequires line to include openldap-devel openssl-devel
  and cups-devel- New upstream version.
- Include post 3.0.6 patch from "Gerald (Jerry) Carter" <jerry@samba.org>
  to fix a duplicate in the LDAP schema.
- Include 64-bit timestamp patch from Ravikumar (rkumar@hp.com)
  to allow correct timestamp handling on 64-bit platforms and fix #126109.
- reenable the -pie patch.  Samba is too widely used, and too vulnerable
  to potential security holes to disable an important security feature
  like -pie.  The correct fix is to have the toolchain not create broken
  executables when programs compiled -pie are stripped.
- Remove obsolete patches.
- Modify this spec file to put libsmbclient.{a,so} in the right place on
  x86_64 machines.- Removed '-pie' patch - 3.0.5 uses -fPIC/-PIC, and the combination
- resulted in executables getting corrupt stacks, causing smbmnt to
- get a SIGBUS in the mount() call (bug 127420).- Upgrade to 3.0.5, which is a regression from 3.0.5pre1 for a
  security fix.
- Include the 3.0.4-backport patch from the 3E branch.  This restores
  some of the 3.0.5pre1 and 3.0.5rc1 functionality.- Backport base64_decode patche to close CAN-2004-0500
- Backport hash patch to close CAN-2004-0686
- use_authtok patch from Nalin Dahyabhai <nalin@redhat.com>
- smbclient-kerberos patch from Alexander Larsson <alexl@redhat.com>
- passwd patch uses "*" instead of "x" for "hashed" passwords for
  accounts created by winbind.  "x" means "password is in /etc/shadow" to
  brain-damaged pam_unix module.- New upstream version
- use % { SOURCE1 } instead of a hardcoded path
- include -winbind patch from Gerald (Jerry) Carter (jerry@samba.org)
  https://bugzilla.samba.org/show_bug.cgi?id=1315
  to make winbindd work against Windows versions that do not have
  128 bit encryption enabled.
- Moved /usr/bin/net to the -common package, so that folks who just
  want to use winbind, etc don't have to install -client in order to
  "net join" their domain.
- New upstream version obsoletes the patches added in 3.0.3-5
- Remove smbgetrc.5 man page, since we don't ship smbget.- rebuilt- Patch to allow password changes from machines patched with
  Microsoft hotfix MS04-011.
- Include patches for https://bugzilla.samba.org/show_bug.cgi?id=1302
  and https://bugzilla.samba.org/show_bug.cgi?id=1309- Samba 3.0.3 released.- New upstream version
- updated spec file to make libsmbclient.so executable.  This closes
  bugzilla #121356- New upstream version  
- Updated configure line to remove --with-fhs and to explicitly set all
  the directories that --with-fhs was setting.  We were overriding most of
  them anyway.  This closes #118598- New upstream version.
- Updated -pie and -logfiles patches for 3.0.3pre1
- add krb5-devel to buildrequires, fixes #116560
- Add patch from Miloslav Trmac (mitr@volny.cz) to allow non-root to run
  "service smb status".  This fixes #116559- rebuilt- Upgrade to 3.0.2a- fix ownership in -common package- rebuilt- Change all requires lines to list an explicit epoch.  Closes #102715
- Add an explicit Epoch so that 0 is defined.- New upstream version: 3.0.2 final includes security fix for #114995
  (CAN-2004-0082)
- Edit postun script for the -common package to restart winbind when
  appropriate.  Fixes bugzilla #114051.- add %dir entries for /usr/lib64/samba and /usr/lib64/samba/charset
- Upgrade to new upstream version
- build mount.cifs for the new cifs filesystem in the 2.6 kernel.- Upgrade to new upstream version- Update to 3.0.1
- Removed testparm patch as it's already merged
- Removed Samba.7* man pages
- Fixed .buildroot patch
- Fixed .pie patch
- Added new /usr/bin/tdbdump file- New 3.0.0 final release
- merge nmbd-netbiosname and testparm patches from 3E branch
- updated the -logfiles patch to work against 3.0.0
- updated the pie patch
- update the VERSION file during build
- use make l .@....m4 exists.- Changed the behaviour in /etc/mail/Makefile to generate the sendmail.cf and
  submit.cf from the mc files if they changed.
- Added a small README.redhat that descibed the new mc file behaviour and the
  split into sendmail.cf and submit.cf.- suggestions form Stephane Lentz:
	- add correct include statement into submit.mc (like sendmail.mc)
	- add commented out further suggestions into submit.mc
	- disable ident lookups- fix initscript for the second daemon and pidfile location #67910- update to 8.12.5- add further queue runs, slight spec-file cleanups- automated rebuild- update to 8.12.4, adjust smrsh patch- automated rebuild- update to 8.12.3- rebuilt- fix alternatives --remove  #61737
- add sendmail/SECURITY as docu #61870, #61545- add libsm.a    #61270
- change from /etc/sendmail.cf to /etc/mail/sendmail.cf
- add milter patch- ignore DAEMON=no; that configuration no longer functions- make sure more version information is in the cf file #54418
- do not use "-b" flag when patching in spec file
- require newer chkconfig version #61035
- fix preun script #60880
- add TMPF to access file creation #60956- mv include files to /usr/include/libmilter/ #60795
- do not use "-f" option to virtusertable #60196
- ad an example smarthost entry to config file #58298- use alternatives --initscript support
- run chkconfig --add before alternatives- run alternatives --remove in %preun
- add some prereqs- fix smmsp useradd invocation in %pre
- switch back to db3 for storing db files- update to 8.12.2 (adds STARTTLS support without need for sfio)
- don't forcibly strip binaries; let the build root handle it
- add creation of the smmsp account (51/51) in %pre
- enable hesiod map support
- modify default config to use an MSP
- comment out 'O AutoRebuildAliases' in %post, otherwise sendmail will
  fail to restart on upgrades- add proper ifdefs around new alternative stuff to also be able
  to build this for older releases- %triggerpostun on older versions to make sure alternatives work on
  upgrades- clean up alternatives somewhat, provide /usr/sbin/sendmail & friends- Use alternatives- fix quotation in spec-file- integrate ugly logic to compile this src.rpm also on older Red Hat
  Linux releases
- clean up spec file and patches a bit
- add db4 support- fix another path to correct docu
- include sendmail/README in the docu
- compile with -D_FFR_WORKAROUND_BROKEN_NAMESERVERS, but do not
  enable this at runtime
- devel subpackage files owned by root now- change "-q" to "-s" as option to make #57216
- move milter lib into separate "devel" sub-package
- add include files to devel sub-package #56064
- fix pointer in access file to docu #54351- add libmilter docu
- add support for userdb to /etc/mail/Makefile
- use "btree" database files if a userdb is used
- buildrequires tcp_wrappers- fix libmilter support
- fix init script to use /etc/mail/Makefile #52932- add libmilter library- update to 8.11.6
- correctly use /etc/mail/statistics- change init script back to older conventions #51297
- remove DoS patch, not needed anymore #51247- add option '-t' to procmail for local mail delivery- point to the map files in sendmail.cf as pointed out by
  David Beveridge <David@beveridge.com>- add build requires #49695
- do not call "userdel"- change sendmail.cf to "noreplace"- update to 8.11.4- update to 8.11.3
- add "localhost.localdomain" to the list of hostnames accepted
  for local delivery "Cw" in /etc/mail/sendmail.mc
- add patches from Pekka Savola <pekkas@netcore.fi>
	- Enable IPv6 at compile time, patch for glibc 2.2 from PLD
	- Add a commented-out IPv6 daemon .mc line to sendmail.mc
	- buildrequire: openldap-devel, cyrus-sasl-devel- rebuild in new environment- add noreplace for /etc/sysconfig/sendmail and /etc/mail/sendmail.mc- add changes from Christopher McCrory <chrismcc@pricegrabber.com>:
	- prepare /etc/mail/Makefile for more maps not shipped with this rpm
	- changed sendmail.mc to include some more commented out options,
	  so that people are directly pointed at imkи@F&?%d
		2|	..	.
X...
	.	.
..`l(
8
$*9
*:*FG.H.Il.JXY\.]h.^ b d!se!xf!}k!l!t!.u"T.v#
w$.x$.y%p{%.%%%A&A
&V&&.&K&g&h&Cpcre-devel6.69.el5Development files for pcreDevelopment files (Headers, libraries for static linking, etc) for pcre.RK	builder17.centos.org(CentOS-5CentOSBSDDevelopment/Librarieshttp://www.pcre.org/linuxi386.a|Vzz(pB8svX^Ch;M

	
Q?h	큤RKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKRKa48b655c696c35728ff0caf9fc8ed07bd00720669f8b75dfea0932683c974896b465e2d593a973cafa09d2de6267c1f342bf4c868454688410544123a86480c246b31c5dbaf368bfcd5fc0dc5c8cf25af5e85bd396fc3c69fec5a91a07d9dba07e73ac2426cf70477f1bcdd351052ad8d6873fba804b86f962cdb3fc06db45ba740713e4ea5ed1aac2640e8c19ced09a5b360329539e731e23ad57d987c7f22a94b8332ac527d81cb6b389829c1502a2dd3066cdd75dcdb9ec085448067c668fd99a28f12cf9fd57c67b1bb7bd0401b2d6f749a1fffa5ade8d9d220bf03a8da1b7003ca94966081581367cb567b64da8e77de075738de3093d2ee6314a339630b3aabf954927ac64acb15fb769e64fd944028b1d8b0925a68edc194db795eee2562ce5f13031524fb392059cb40feec235b14e4512aa9718d7b8a09c9099ce5e4ec5ec82bd2ac3d4a0e8d446858cc3ccada1cb46ef5c8ecf537a9000bee96e3bf894b270bf45b1cb11b26118acc0bddf8f65370b42299a89b3589727ddd02509649f057d58f8883ef338a25a6f79a5f69362033e3e80021b2e4646534a2b24e9f7c4e8a071f7951ae7fefe681e4f3846af10c54f54197d5b73fe339d88e3bf1e020f7172980cb1bba539c0555634699d70dbfd7632f01c33322b2686af19cecdd880c3ac7c8b2cd047242f6b9bc0c77a80807ffae947b693962b98daf443cc2e23bde7b45e4f865e4fe4a8e9dc03048a1ea0017ecf5ae77baf454a7433a1b3e74bd8f9fbb2239b62947eca72aa5d8b5240c271c35ec2de3cbf3ffd24c056653f2d196308f21c51ecc405faf0bdde7c6e44e13b15440a8e7bb0dbd05b08cd5f584f954c8767592e5617258afbfdd498771675d4fb4b597505d90b2ca309b91c1bc51c263c6ec6db7baae6fa245ef9f2831f7e78a392a7b710280511d943c13060c41c966193912cc047968b2398c500f7../../lib/libpcre.so.0libpcrecpp.so.0.0.0libpcreposix.so.0.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootro`kPu@Qcap.so()(64bit)clone.so()(64bit)compctl.so()(64bit)complete.so()(64bit)complist.so()(64bit)computil.so()(64bit)config(zsh)datetime.so()(64bit)deltochar.so()(64bit)example.so()(64bit)files.so()(64bit)langinfo.so()(64bit)mapfile.so()(64bit)mathfunc.so()(64bit)parameter.so()(64bit)rlimits.so()(64bit)sched.so()(64bit)socket.so()(64bit)stat.so()(64bit)system.so()(64bit)tcp.so()(64bit)termcap.so()(64bit)zftp.so()(64bit)zle.so()(64bit)zleparameter.so()(64bit)zprof.so()(64bit)zpty.so()(64bit)zselect.so()(64bit)zutil.so()(64bit)zsh@	@@@@@@@@@@@@@@@@JJ@/bin/sh/bin/sh/bin/sh/sbin/install-infoconfig(zsh)fileutilsgreplibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcaplibdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libnsl.so.1()(64bit)libtermcap.so.2()(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)4.2.6-10.el5_113.0.4-14.0-14.4.2.3U[`Qo`P2`ON%L*Lc`I`Eh`E`D`CC`CE`C`B6	`B6	`AA`@`@q`@xn`@E@-H@j`?E?s>>k>>H >/`>
*`=`==`=n`=`=<f`<`<)<um<<`;;9;e;9;1;`;I:0:$`:;`:#`:Q`:Z8`:$*:9n;9_`9=t`9O8{8588~J7`7Պ77A76`6k6`6R6y~5K5y5y5S`5/4M%3
3MbKamil Dudka <kdudka@redhat.com> - 4.2.6-10James Antill <jantill@redhat.com> - 4.2.6-9James Antill <jantill@redhat.com> - 4.2.6-8James Antill <jantill@redhat.com> - 4.2.6-7James Antill <jantill@redhat.com> - 4.2.6-6James Antill <jantill@redhat.com> - 4.2.6-5James Antill <jantill@redhat.coi @ to 1.17- update to 1.16- add patch to fix SIGUSR1 kills.- rebuild against new glibc in the sparc tree- update mke2fs man page so that it reflects changes in mke2fs
  netweem 1.14 and 1.15- fix lsattr on alpha- update to 1.15.- auto rebuild in the new build environment (release 4)- fix fsck segfault- update to 1.14
- use %configure to generate config.sub on arm- fix /usr/bin/compile_et and doco for com_err.h (#673)- build with prefix=/usr
- add arm patch- update to 1.13.- recompile statically linked binary for 5.2/sparc- upgrade to 1.12.- translations modified for de, fr, tr- include <asm/types.h> to match kernel types in utils- spec file cleanups- fixed broken llseek() prototype- added patch to prototype llseek- built against glibc/bin/shbuilder17.centos.org 14110349790000000000000000000000000000000000000000000000000000000000000csdeesfritnlplrwsvtr1.39-37.el51.39-37.el5	

blkidmke2fs.confbadblocksblkiddebugfsdumpe2fse2fscke2imagee2labelfindfsfsckfsck.ext2fsck.ext3logsavemke2fsmkfs.ext2mkfs.ext3resize2fstune2fschattrlsattruuidgenfilefragmklost+founde2fsprogs-1.39READMERELEASE-NOTESe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.moe2fsprogs.mochattr.1.gzlsattr.1.gzuuidgen.1.gze2fsck.conf.5.gzmke2fs.conf.5.gzbadblocks.8.gzblkid.8.gzdebugfs.8.gzdumpe2fs.8.gze2fsck.8.gze2image.8.gze2label.8.gzfilefrag.8.gzfindfs.8.gzfsck.8.gzfsck.ext2.8.gzfsck.ext3.8.gzlogsave.8.gzmke2fs.8.gzmkfs.ext2.8.gzmkfs.ext3.8.gzmklost+found.8.gzresize2fs.8.gztune2fs.8.gz/etc//sbin//usr/bin//usr/sbin//usr/share/doc//usr/share/doc/e2fsprogs-1.39//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/rw/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=genericcpiogzip9x86_64x86_64-redhat-linux-gnuASCII English textASCII textELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, statically linked, strippeddirectory$+6AJO[gsz	8k@@ng@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>John H Terpstra <jht@samba.anu.edu.au>John H Terpstra <jht@samba.anu.edu.au>John H Terpstra <jht@samba.anu.edu.au>- Security Release "BadLock"
- resolves: CVE-2016-2110
- resolves: CVE-2016-2111- Security Release, fixes CVE-2013-0213 and CVE-2013-4124
- resolves: #1073351- Security Release, fixes CVE-2012-1182
- resolves: #804639- Security release, fixes CVE-2012-0870
- resolves: #795719- Regenerate manpage for "wide links" and "unix extensions" sections
- related: #722553- Security Release, fixes CVE-2010-0926
- resolves: #722553- Fix smbclient return code
- resolves: #768908- Fix support for Windows 2008 R2 domains
- resolves: #736124- Security Release, fixes CVE-2010-0547, CVE-2010-0787, CVE-2011-2694,
  CVE-2011-2522, CVE-2011-1678, CVE-2011-2724
- resolves: #722553- Security Release, fixes CVE-2011-0719
- resolves: #678331- Security Release, fixes CVE-2010-3069
- resolves: #632230- Security Release, fixes CVE-2010-2063
- resolves: #602321- Put libsmbclient library into a separate package
- resolves: #555654- Remove -t option from smbcacls
- resolves: #457096- Fix mtab locking in mount.cifs
- resolves: #533912- Fix smbget, rpcclient, smbtree, pdbedit, smbclient and smbcacls manpage
- resolves: #457195, #457082, #457203, #457384, #457192, #457097- Update cifs.upcall to upstream version
- resolves: #517195- Fix POSIX open in trans2 server implementation
- resolves: #522866- Offline file fix for Vista and Office 2003
- resolves: #522881- Use generated krb5.conf for "net ads testjoin" and "net ads leave"
- resolves: #509170- Allow to call "pdbedit -u user -N description" without "-r"
- resolves: #457385- Avoid enumeration of trusted domains when "allow trusted domains = no"
- resolves: #526065- Fix credentials file handling for mount.cifs.
- resolves: #532153- Security Release, fixes CVE-2009-1888, CVE-2009-2813, CVE-2009-2948 and CVE-2009-2906
- resolves: #526661- Fix posix open
- resolves: #493728- Fix pdbedit manpage
- resolves: #457381- Fix recycle vfs module
- resolves: #470897- Add patches to mount.cifs.c to fix various errors in mount codes.
- resolves: #465979- Hotfix for bug unix_convert().
- resolves: #497156- Include full /usr/lib/samba/auth path.
- resolves: #481815- Raise log level for annoying messages that are normal with
  some idmap backends.
- resolves: #485382- Fix regression in ACL inheritance patch.
- resolves: #481046- Fix ACL inheritance
- resolves: #471605- Rebase to 3.0.33 which is just 3.0.32 + CVE-2008-4314 security patch
- resolves: CVE-2008-4314- Fix machine account password change
- resolves: #461744- Add cifs.upcall
- resolves: #453655- Update to 3.0.32
- Fix machine account password change
- resolves: #447598
- resolves: #461744- Fix joining and authentication with NT4 and Windows 2000 domains.
- resolves: #449000
- resolves: #450533- Security fix for CVE-2008-1105
- Fix join verification
- Fix smb signing
- resolves: CVE-2008-1105
- resolves: #447380
- resolves: #444637- Yet another 2 patches for regressions related to operations on a DC with
  trusted domains. Fiux idmap with legacy configuration options, and fix the
  pam module, pam logins were broken for trusted domains
- related: #429024- Add another 2 patches to solve 429024 completely, as some cases were not
  covered:
  - Fix domain trusts while running as a DC
  - Fix credential chain with windows 2008
- Make some configure flag explicit even if they are on by default so that we
  can catch build errors if something is wrong instead of silently missing
  features supposed to be compiled in
- related: #429024- Back out moiunt cifs patches for prepath, as the corresponding
  kernel changes can't be put in at this time
- Add a minor SPNEGO fix
- related: #370501
- related: #291501- A7jP%@Zickus <dzickus@redhat.com> [2.6.18-94.el5]Don Zickus <dzickus@redhat.com> [2.6.18-93.el5]Don Zickus <dzickus@redhat.com> [2.6.18-92.el5]Don Zickus <dzickus@redhat.com> [2.6.18-91.el5]Don Zickus <dzickus@redhat.com> [2.6.18-90.el5]Don Zickus <dzickus@redhat.com> [2.6.18-89.el5]Don Zickus <dzickus@redhat.com> [2.6.18-88.el5]Don Zickus <dzickus@redhat.com> [2.6.18-87.el5]Don Zickus <dzickus@redhat.com> [2.6.18-86.el5]Don Zickus <dzickus@redhat.com> [2.6.18-85.el5]Don Zickus <dzickus@redhat.com> [2.6.18-84.el5]Don Zickus <dzickus@redhat.com> [2.6.18-83.el5]Don Zickus <dzickus@redhat.com> [2.6.18-82.el5]Don Zickus <dzickus@redhat.com> [2.6.18-81.el5]Don Zickus <dzickus@redhat.com> [2.6.18-80.el5]Don Zickus <dzickus@redhat.com> [2.6.18-79.el5]Don Zickus <dzickus@redhat.com> [2.6.18-78.el5]Don Zickus <dzickus@redhat.com> [2.6.18-77.el5]Don Zickus <dzickus@redhat.com> [2.6.18-76.el5]Don Zickus <dzickus@redhat.com> [2.6.18-75.el5]Don Zickus <dzickus@redhat.com> [2.6.18-74.el5]Don Zickus <dzickus@redhat.com> [2.6.18-73.el5]Don Zickus <dzickus@redhat.com> [2.6.18-72.el5]Don Zickus <dzickus@redhat.com> [2.6.18-71.el5]Don Zickus <dzickus@redhat.com> [2.6.18-70.el5]Don Zickus <dzickus@redhat.com> [2.6.18-69.el5]Don Zickus <dzickus@redhat.com> [2.6.18-68.el5]Don Zickus <dzickus@redhat.com> [2.6.18-67.el5]Don Zickus <dzickus@redhat.com> [2.6.18-66.el5]Don Zickus <dzickus@redhat.com> [2.6.18-65.el5]Don Zickus <dzickus@redhat.com> [2.6.18-64.el5]Don Zickus <dzickus@redhat.com> [2.6.18-63.el5]Don Zickus <dzickus@redhat.com> [2.6.18-62.el5]Don Zickus <dzickus@redhat.com> [2.6.18-61.el5]Don Zickus <dzickus@redhat.com> [2.6.18-60.el5]Don Zickus <dzickus@redhat.com> [2.6.18-59.el5]Don Zickus <dzickus@redhat.com> [2.6.18-58.el5]Don Zickus <dzickus@redhat.com> [2.6.18-57.el5]Don Zickus <dzickus@redhat.com> [2.6.18-56.el5]Don Zickus <dzickus@redhat.com> [2.6.18-55.el5]Don Zickus <dzickus@redhat.com> [2.6.18-54.el5]Don Zickus <dzickus@redhat.com> [2.6.18-53.el5]Don Zickus <dzickus@redhat.com> [2.6.18-52.el5]Don Zickus <dzickus@redhat.com> [2.6.18-51.el5]Don Zickus <dzickus@redhat.com> [2.6.18-50.el5]Don Zickus <dzickus@redhat.com> [2.6.18-49.el5]Don Zickus <dzickus@redhat.com> [2.6.18-48.el5]Don Zickus <dzickus@redhat.com> [2.6.18-47.el5]Don Zickus <dzickus@redhat.com> [2.6.18-46.el5]Don Zickus <dzickus@redhat.com> [2.6.18-45.el5]Don Zickus <dzickus@redhat.com> [2.6.18-44.el5]Don Zickus <dzickus@redhat.com> [2.6.18-43.el5]Don Zickus <dzickus@redhat.com> [2.6.18-42.el5]Don Zickus <dzickus@redhat.com> [2.6.18-41.el5]Don Zickus <dzickus@redhat.com> [2.6.18-40.el5]Don Zickus <dzickus@redhat.com> [2.6.18-39.el5]Don Zickus <dzickus@redhat.com> [2.6.18-38.el5]Don Zickus <dzickus@redhat.com> [2.6.18-37.el5]Don Zickus <dzickus@redhat.com> [2.6.18-36.el5]Don Zickus <dzickus@redhat.com> [2.6.18-35.el5]Don Zickus <dzickus@redhat.com> [2.6.18-34.el5]Don Zickus <dzickus@redhat.com> [2.6.18-33.el5]Don Zickus <dzickus@redhat.com> [2.6.18-32.el5]Don Zickus <dzickus@redhat.com> [2.6.18-31.el5]Don Zickus <dzickus@redhat.com> [2.6.18-30.el5]Don Zickus <dzickus@redhat.com> [2.6.18-29.el5]Don Zickus <dzickus@redhat.com> [2.6.18-28.el5]Don Zickus <dzickus@redhat.com> [2.6.18-27.el5]Don Zickus <dzickus@redhat.com> [2.6.18-26.el5]Don Zickus <dzickus@redhat.com> [2.6.18-25.el5]Don Zickus <dzickus@redhat.com> [2.6.18-24.el5]Don Zickus <dzickus@redhat.com> [2.6.18-23.el5]Don Zickus <dzickus@redhat.com> [2.6.18-22.el5]Don Zickus <dzickus@redhat.com> [2.6.18-21.el5]Don Howard <dhoward@redhat.com> [2.6.18-20.el5]Don Zickus <dzickus@redhat.com> [2.6.18-19.el5]Don Zickus <dzickus@redhat.com> [2.6.18-18.el5]Don Zickus <dzickus@redhat.com> [2.6.18-17.el5]Don Zickus <dzickus@redhat.com> [2.6.18-16.el5]Don Zickus <dzickus@redhat.com> [2.6.18-15.el5] Don Zickus <dzickus@redhat.com> [2.6.18-14.el5]Don Zickus <dzickus@redhat.com> [2.6.18-13.el5]Don Zickus <dzickus@redhat.com> [2.6.18-12.el5]Don Zickus <dzickus@redhat.com> [2.6.18-10.el5]Don Zickus <dzickus@redhat.com> [2.6.18-9kG@GF-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.moredhat-dist.mo/etc/rpm//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_US/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/hy/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/ilo/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ku/LC_MESSAGES//usr/share/locale/lo/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/my/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/no/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@Latn/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/ur/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES/-O2cpiogzip9noarchnoarch-redhat-linux-gnuASCII textdirectory?^fS ;a|qhk?P)bGV(`2W=ͥ:;ڝSmܰJ /sk2aTՈ?P)bGV(5c=pц]%fsk#OfX\jEDN~fleV
I_?8a8f8796653efba5b534e440425367150fd0e407\=lh.@...Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Than Ngo <than@redhat.de>Florian La Roche <Florian.LaRoche@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Bernhard Rosenkränzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Donnie Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Backported SSL options configuration
  Resolves: rhbz#1157811- fix MAXHOSTNAMELEN for FQDN
  Resolves: rhbz#640232- rpm attributes S,5,T not recorded for statistics file- fix specfile for passing rpm -V test (#555277)- fix verification of SSL certificate with NUL in name (#553618, CVE-2009-4565)
- do not accept localhost.localdomain as valid address from smtp (#449391)
- skip colon separator when parsing service name in ServiceSwitchFile (#512871)
- exit with non-zero error code when free space is low (#299951)
- fix -qG description in man page (#250552)
- fix comments in sendmail.mc to use correct certs path (#244012)
- add MTA to provides (#494408)
- fix %dist macro use (#440616)
- compile with -fno-strict-aliasing
- skip t-sem test as it doesn't allow parallel testing- added missing LDAP_DEPRECATED flag
  Resolves: rhbz#217533- unify sendmailjP@rov) [459901]
- [acpi] tell platformthat we support fixed hw T-states (Matthew Garrett) [569590]
- [edac] i7core_edac: Backport driver to RHEL5 (Mauro Carvalho Chehab) [468877]
- [edac] i7core_edac: add driver for new Nehalem (Mauro Carvalho Chehab) [468877]
- [x86_64] mce: fix misplaced `continue' in mce.c (Mauro Carvalho Chehab) [468877]
- [pci] Add a probing code that seeks for an specific bus (Mauro Carvalho Chehab) [468877]
- [edac] add support for DDR3 at EDAC core (Mauro Carvalho Chehab) [468877]
- [wireless] Kconfig: select WIRELESS_COMPAT as needed (John Linville) [583767]
- [i386] oprofile: fix detection of Intel CPU family 6 (John Villalovos) [581919]
- [misc] intel: support for Intel Cougar Point Chipset (John Villalovos) [566854]
- [fs] xfs: don't let swapext operate on write-only files (Jiri Pirko) [605161] {CVE-2010-2226}
- [fs] nfs: fix bug in nfsd4 read_buf (Jiri Olsa) [612035] {CVE-2010-2521}
- [fs] nfsd: add lockdep annotation to nfsd4 recover code (Jeff Layton) [567092]
- [fs] nfs: wait for close before silly-renaming (Jeff Layton) [565974]
- [fs] cifs: enable CONFIG_CIFS_STATS (Jeff Layton) [574795]
- [net] sunrpc: translate an -ENETUNREACH to -ENOTCONN (Jeff Layton) [481372]
- [fs] cifs: merge CIFSSMBQueryEA with CIFSSMBQAllEAs (Jeff Layton) [527268]
- [fs] cifs: verify lengths of QueryAllEAs reply (Jeff Layton) [527268]
- [fs] cifs: increase maximum buffer size in CIFSSMBQAllEAs (Jeff Layton) [527268]
- [fs] cifs: rename name_len to list_len in CIFSSMBQAllEAs (Jeff Layton) [527268]
- [fs] cifs: clean up indentation in CIFSSMBQAllEAs (Jeff Layton) [527268]
- [fs] cifs: reject DNS upcall add_key req from userspace (Jeff Layton) [612171] {CVE-2010-2524}
- [fs] cifs: add parens around smb_var in BCC macros (Jeff Layton) [527268]
- [security] keys: new key flag for add_key from userspace (Jeff Layton) [612171] {CVE-2010-2524}
- [specfile] skip xen tarball and patching if building w/o xen (Jarod Wilson)
- [specfile] replace ancient and deprecated rpm syntax (Jarod Wilson)
- [virt] xen: remove sysdata hack from irq-xen.c (Paolo Bonzini) [561390]
- [xen] msi fixmap cleanup and vector teardown (Don Dugger) [516236]- [x86] kprobes: introduce kprobes jump optimization (Masami Hiramatsu) [516313]
- [x86] add x86_64 alternatives_text_reserved interface (Masami Hiramatsu) [516313]
- [x86_64] kprobes: upstream update for rhel5.6 (Masami Hiramatsu) [516313]
- [x86_64] add instruction decoder API (Masami Hiramatsu) [516313]
- [fusion] mpt: fix deregister calls in exit path (hiro muneda) [581523]
- [net] cxgb3: wait longer for control packets on init (Steve Best) [587670]
- [scsi] scsi_dh_alua: add IBM Power Virtual SCSI ALUA dev (Steve Best) [567292]
- [fs] gfs2: fix stuck in inode wait, no glocks stuck (Robert S Peterson) [595397]
- [message] mptsas: fix disk add failing due to timeout (Rob Evers) [542892]
- [scsi] lpfc: update from 8.2.0.73.1p to 8.2.0.76.1p (Rob Evers) [591674]
- [scsi] lpfc: update from 8.2.0.63.p3 to 8.2.0.73.1p (Rob Evers) [571862]
- [i2c] fix exports types for recently added i2c symbols (Prarit Bhargava) [611774]
- [virt] xen: fix 32-bit syscalls on 64-bit kernel (Paolo Bonzini) [561394]
- [virt] xen: add tracepoint for kernel pagefault event (Paolo Bonzini) [561385]
- [security] selinux: fix race with re-parenting (Oleg Nesterov) [556675]
- [net] sctp: fix length checks (Neil Horman) [605305]
- [acpi] intel: avoid skipping ARB_DISABLE on model 0x0e (Matthew Garrett) [602846]
- [block] cfq-iosched: fix bad locking in changed_ioprio (Jeff Moyer) [582435]
- [block] cfq-iosched: kill cfq_exit_lock (Jeff Moyer) [582435]
- [fs] cifs: fix kernel BUG with remote OS/2 server (Jeff Layton) [608588] {CVE-2010-2248}
- [fs] cifs: don't try busy-file rename unless in same dir (Jeff Layton) [603706]
- [fs] nfsd: don't break lease while servicing COMMIT call (Jeff Layton) [575817]
- [fs] force target reval when following LAST_BIND symlinks (Jeff Layton) [571518]
- [net] be2net: update to v2.102.348r with SR-IOV support (Ivan Vecera) [568388]
- [net] virtio_net: add set_multicast_=k005@564 "obey pam restrictions" statement - it's not
  active, as we use encrypted passwords, but if the admin turns
  encrypted passwords off the choice is available. (#31351)- Use /var/cache/samba instead of /var/lock/samba 
- Remove "domain controller" keyword from smb.conf, it's 
  deprecated (from #13704)
- Sync some examples with smb.conf.default
- Fix password synchronization (#16987)- Tweaks of BuildRequires (#49581)- 2.2.1a bugfix release- 2.2.1, which should work better for XP- 2.2.0a security fix
- Mark lograte and pam configuration files as noreplace- Add the /etc/samba directory to samba-common- Add improvements to the smb.conf as suggested in #16931(these changes are from the non-head version)
- Don't include /usr/sbin/samba, it's the same as the initscript
- unset TMPDIR, as samba can't write into a TMPDIR owned 
  by root (#41193)
- Add pidfile: lines for smbd and nmbd and a config: line
  in the initscript  (#15343)
- don't use make -j
- explicitly include /usr/share/samba, not just the files in it- mount.smb/mount.smbfs go in /sbin, *not* %{_sbindir}- enable encypted passwords by default- build as 2.2.0-1 release
- skip the documentation-directories docbook, manpages and yodldocs
- don't include *.sgml documentation in package
- moved codepage-directory to /usr/share/samba/codepages
- make it compile with glibc-2.2.3-10 and kernel-headers-2.4.2-2- updated to samba 2.2.0
- moved codepages to /usr/share/samba/codepages
- use all available CPUs for building rpm packages
- use %{_xxx} defines at most places in spec-file
- "License:" replaces "Copyright:"
- dropped excludearch sparc
- de-activated japanese patches 100 and 200 for now 
  (they need to be fixed and tested wth 2.2.0)
- separated swat.desktop file from spec-file and added
  german translations
- moved /etc/sysconfig/samba to a separate source-file
- use htmlview instead of direct call to netscape in 
  swat.desktop-file- device-remove security fix again (<tridge@samba.org>)- fix tempfile security problems, officially (<tridge@samba.org>)
- update to 2.0.8- turn of SSL, kerberos- fix tempfile security problems (patch from <Marcus.Meissner@caldera.de>)- fix quota support, and quotas with the 2.4 kernel (#31362, #33915)- tweak the PAM code some more to try to do a setcred() after initgroups()
- pull in all of the optflags on i386 and sparc
- don't explicitly enable Kerberos support -- it's only used for password
  checking, and if PAM is enabled it's a no-op anyway- exit successfully from preun script (bug #30644).- rebuild in new environment- updated japanese stuff (#27683)- fix trigger (#26859)- add i18n support, japanese patch (#26253)- i18n improvements in initscript (#26537)- put smbpasswd in samba-common (#25429)- new i18n stuff- rebuild- i18n-ize initscript
- add a sysconfig file for daemon options (#23550)
- clarify smbpasswd man page (#23370)
- build with LFS support (#22388)
- avoid extraneous pam error messages (#10666)
- add Urban Widmark's bug fixes for smbmount (#19623)
- fix setgid directory modes (#11911)
- split swat into subpackage (#19706)- set a default CA certificate path in smb.conf (#19010)
- require openssl >= 0.9.5a-20 to make sure we have a ca-bundle.crt file- fix swat only_from line (#18726, others)
- fix attempt to write outside buildroot on install (#17943)- add smbspool back in (#15827)
- fix absolute symlinks (#16125)- bugfix for smbadduser script (#15148)- patch configure.ing (patch11) to disable cups test
- turn off swat by default- fix condrestart stuff- add copytruncate to logrotate file (#14360)
- fix init script (#13708)- move initscript back
- remove 'Using Samba' book from %doc 
- move stuff to /etc/samba (#13708)
- default configuration tweaks (#13704)
- some logrotate tweaks- automatic rebuild- fix logrotate script (#13698)- fix initscripts req (prereq /etc/init.d)- add initdir macro to handle the initscript directory
- add a new macro to handle /etc/pam.d/system-auth- enable Kerberos 5 and SSL support
- patch for duplicate profile.h headers- fix ikp=,@config(vim-common)vim-common@@@@@@@JJ@/bin/gawk/bin/shconfig(vim-common)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)2:7.0.109-7.2.el53.0.4-14.0-1man-pages-frman-pages-itman-pages-pl0.9.7-140.3.0-170.24-24.4.2.3OOk`LYJ2J0,J`IoI9HLHX`H{`Hv`Hk`F;F9	F9	EEEEEh`E-E`D`DD
`DrD!`DDCDZDqDBDDpD`D`DoDoDoD|`DfVDe`DcDbb`DaD_`DW`DR`DH`D<&D6D5`D2`D!DD<Karsten Hopp <karsten@redhat.com> 7.0.109-7.2Karsten Hopp <karsten@redhat.com> 7.0.109-7.1Karsten Hopp <karsten@redhat.com> 7.0.109-7Karsten Hopp <karsten@redhat.com> 7.0.109-6Karsten Hopp <karsten@redhat.com> 7.0.109-5.6Karsten Hopp <karsten@redhat.com> 7.0.109-5.4Karsten Hopp <karsten@redhat.com> 7.0.109-5.3Karsten Hopp <karsten@redhat.com> 7.0.109-5.1Karsten Hopp <karsten@redhat.com> 7.0.109-5.1Karsten Hopp <karsten@redhat.com> 7.0.109-5Karsten Hopp <karsten@redhat.com> 7.0.109-3.6Karsten Hopp <karsten@redhat.cj@
 faults (Scott Moser ) [285981]
- [s390] qdio: Refresh buffer states for IQDIO Asynch output queue (Hans-Joachim Picht ) [222181]
- [scsi] fusion: allow VMWare's emulator to work again (Chip Coldwell ) [279571]- [XEN] x86: 32-bit ASID mode hangs dom0 on AMD (Chris Lalancette ) [275371]
- [scsi] megaraid_sas: intercept cmd timeout and throttle io (Chip Coldwell ) [245184 247581]
- [s390] hypfs: inode corruption due to missing locking (Brad Hinson ) [254169]
- [Xen] Allow 32-bit Xen to kdump >4G physical memory (Stephen C. Tweedie ) [251341]
- [ptrace] NULL pointer dereference triggered by ptrace (Anton Arapov ) [275991] {CVE-2007-3731}
- [XEN] ia64: allocating with GFP_KERNEL in interrupt context fix (Josef Bacik ) [279141]- [XEN] Update spec file to provide specific xen ABI version (Stephen C. Tweedie ) [271981]
- [scsi] qla2xxx: nvram/vpd updates produce soft lockups and system hangs (Marcus Barrow ) [260701]
- [scsi] iscsi: borked kmalloc  (Mike Christie ) [255841]
- [net] qla3xxx: Read iSCSI target disk fail (Marcus Barrow ) [246123]
- [net] igmp: check for NULL when allocating GFP_ATOMIC skbs (Neil Horman ) [252404]
- [mm] madvise call to kernel loops forever (Konrad Rzeszutek ) [263281]- [misc] re-export some symbols as EXPORT_SYMBOL_GPL (Jon Masters ) [252377]
- [xen] ia64: set NODES_SHIFT to 8 (Doug Chapman ) [254050]
- [xen] Fix privcmd to remove nopage handler (Chris Lalancette ) [249409]
- [xen] increase limits to boot on large ia64 platforms (Doug Chapman ) [254062]
- [autofs] autofs4 - fix race between mount and expire (Ian Kent ) [236875]
- [nfs] NFS4: closes and umounts are racing (Steve Dickson ) [245062]
- [GFS2] Fix lock ordering of unlink (Steven Whitehouse ) [253609]
- [openib] Fix two ipath controllers on same subnet (Doug Ledford ) [253005]
- [net] tg3: update to fix suspend/resume problems (Andy Gospodarek ) [253988]
- [GFS2] distributed mmap test cases deadlock (Benjamin Marzinski ) [248480]
- [GFS2] Fix inode meta data corruption (Wendy Cheng ) [253590]
- [GFS2] bad mount option causes panic with NULL superblock pointer (Abhijith Das ) [253921]
- [fs] hugetlb: fix prio_tree unit (Konrad Rzeszutek ) [253930]
- [misc] Microphone stops working (John Feeney ) [240716]
- [GFS2] glock dump dumps glocks for all file systems (Abhijith Das ) [253238]
- [scsi] qla2xxx: disable MSI-X by default (Marcus Barrow ) [252410]- [XEN] remove assumption first numa node discovered is node0 (Jarod Wilson ) [210078]- [GFS2] More problems unstuffing journaled files (Bob Peterson ) [252191]
- [DLM] Reuse connections rather than freeing them (Patrick Caulfield ) [251179]
- [ppc] EEH: better status string detection (Scott Moser ) [252405]
- [scsi] cciss: set max command queue depth (Tomas Henzl ) [251167]
- [audit] Stop multiple messages from being printed (Eric Paris ) [252358]
- [scsi] uninitialized field in gdth.c (Chip Coldwell ) [245550]
- [scsi] SATA RAID 150-4/6 do not support 64-bit DMA (Chip Coldwell ) [248327]
- [gfs2] fix truncate panic (Wendy Cheng ) [251053]
- [gfs2] panic after can't parse mount arguments  (Benjamin Marzinski ) [253289]
- [fs] CIFS: fix deadlock in cifs_get_inode_info_unix (Jeff Layton ) [249394]
- [sound] support ad1984 codec (Brian Maly ) [252373]
- [scsi] fix iscsi write handling regression (Mike Christie ) [247827]
- [ppc] Fix detection of PCI-e based devices (Doug Ledford ) [252085]
- [gfs2] unstuff quota inode (Abhijith Das ) [250772]
- [net] fix DLPAR remove of eHEA logical port (Scott Moser ) [251370]
- [gfs2] hang when using a large sparse quota file (Abhijith Das ) [235299]
- [x86_64] Fix MMIO config space quirks (Bhavana Nagendra ) [252397]
- [misc] Convert cpu hotplug notifiers to use raw_notifier (Peter Zijlstra ) [238571]
- [sound] fix panic in hda_codec (Brian Maly ) [251854]
- [mm] separate mapped file and anonymous pages in show_mem() output. (Larry Woodman ) [252033]
- [misc] Fix broken AltSysrq-F (Larry Woodman ) [251731]
- [scsi] cciss: increase max sectors to 2048 (Tomas Henzl ) [248121]
- Revert [gfs2] remounting w/o acl option leaves acls e-l4@afu1
$HF}эh^
(k@@hp-roman8.psiso-8859-10.psiso-8859-11.psiso-8859-13.psiso-8859-14.psiso-8859-15.psiso-8859-2.psiso-8859-3.psiso-8859-4.psiso-8859-5.psiso-8859-7.psiso-8859-8.psiso-8859-9.psjis_roman.pskoi8-r.pskoi8-u.psks_roman.pslatin1.psmac-roman.psprolog.psscripts.vimspellcleanadd.vimen.ascii.splen.ascii.sugen.latin1.splen.latin1.sugen.utf-8.splen.utf-8.sughe.vimyi.vimsynmenu.vimsyntax2html.vimREADME.txta2ps.vima65.vimaap.vimabap.vimabaqus.vimabc.vimabel.vimacedb.vimada.vimaflex.vimahdl.vimalsaconf.vimamiga.vimaml.vimampl.vimant.vimantlr.vimapache.vimapachestyle.vimarch.vimart.vimasm.vimasm68k.vimasmh8300.vimasn.vimaspperl.vimaspvbs.vimasterisk.vimasteriskvm.vimatlas.vimautomake.vimave.vimawk.vimayacc.vimb.vimbaan.vimbasic.vimbc.vimbdf.vimbib.vimbindzone.vimblank.vimbst.vimbtm.vimc.vimcalendar.vimcatalog.vimcdl.vimcf.vimcfg.vimch.vimchange.vimchangelog.vimchaskell.vimcheetah.vimchill.vimchordpro.vimcl.vimclean.vimclipper.vimcmake.vimcmusrc.vimcobol.vimcolortest.vimconf.vimconfig.vimcontext.vimcpp.vimcrm.vimcrontab.vimcs.vimcsc.vimcsh.vimcsp.vimcss.vimcterm.vimctrlh.vimcupl.vimcuplsim.vimcvs.vimcvsrc.vimcweb.vimcynlib.vimcynpp.vimd.vimdcd.vimdcl.vimdebchangelog.vimdebcontrol.vimdebsources.vimdef.vimdesc.vimdesktop.vimdictconf.vimdictdconf.vimdiff.vimdircolors.vimdiva.vimdjango.vimdns.vimdocbk.vimdocbksgml.vimdocbkxml.vimdosbatch.vimdosini.vimdot.vimdoxygen.vimdracula.vimdsl.vimdtd.vimdtml.vimdylan.vimdylanintr.vimdylanlid.vimecd.vimedif.vimeiffel.vimelf.vimelinks.vimelmfilt.vimerlang.vimeruby.vimesmtprc.vimesqlc.vimesterel.vimeterm.vimeviews.vimexim.vimexpect.vimexports.vimfasm.vimfdcc.vimfetchmail.vimfgl.vimflexwiki.vimfocexec.vimform.vimforth.vimfortran.vimfoxpro.vimfstab.vimfvwm.vimfvwm2m4.vimgdb.vimgdmo.vimgedcom.vimgkrellmrc.vimgnuplot.vimgp.vimgpg.vimgrads.vimgretl.vimgroff.vimgroovy.vimgroup.vimgrub.vimgsp.vimgtkrc.vimhaskell.vimhb.vimhelp.vimhercules.vimhex.vimhitest.vimhog.vimhtml.vimhtmlcheetah.vimhtmldjango.vimhtmlm4.vimhtmlos.vimia64.vimicemenu.vimicon.vimidl.vimidlang.vimindent.viminform.viminitex.viminitng.viminittab.vimipfilter.vimishd.vimiss.vimist.vimjal.vimjam.vimjargon.vimjava.vimjavacc.vimjavascript.vimjess.vimjgraph.vimjproperties.vimjsp.vimkconfig.vimkix.vimkscript.vimkwt.vimlace.vimlatte.vimld.vimldif.vimlex.vimlftp.vimlhaskell.vimlibao.vimlifelines.vimlilo.vimlimits.vimlisp.vimlite.vimloginaccess.vimlogindefs.vimlogtalk.vimlotos.vimlout.vimlpc.vimlprolog.vimlscript.vimlss.vimlua.vimlynx.vimm4.vimmail.vimmailaliases.vimmailcap.vimmake.vimman.vimmanconf.vimmanual.vimmaple.vimmasm.vimmason.vimmaster.vimmatlab.vimmaxima.vimmel.vimmessages.vimmf.vimmgl.vimmgp.vimmib.vimmma.vimmmix.vimmodconf.vimmodel.vimmodsim3.vimmodula2.vimmodula3.vimmonk.vimmoo.vimmp.vimmplayerconf.vimmrxvtrc.vimmsidl.vimmsql.vimmupad.vimmush.vimmuttrc.vimmysql.vimnamed.vimnanorc.vimnasm.vimnastran.vimnatural.vimncf.vimnetrc.vimnetrw.vimnosyntax.vimnqc.vimnroff.vimnsis.vimobjc.vimobjcpp.vimocaml.vimoccam.vimomnimark.vimopenroad.vimopl.vimora.vimpamconf.vimpapp.vimpascal.vimpasswd.vimpcap.vimpccts.vimperl.vimpf.vimpfmain.vimphp.vimphtml.vimpic.vimpike.vimpilrc.vimpine.vimpinfo.vimplaintex.vimplm.vimplp.vimplsql.vimpo.vimpod.vimpostscr.vimpov.vimpovini.vimppd.vimppwiz.vimprescribe.vimprocmail.vimprogress.vimprolog.vimprotocols.vimpsf.vimptcap.vimpurifylog.vimpyrex.vimpython.vimqf.vimquake.vimr.vimracc.vimradiance.vimratpoison.vimrc.vimrcs.vimrcslog.vimreadline.vimrebol.vimregistry.vimremind.vimresolv.vimrexx.vimrhelp.vimrib.vimrnc.vimrnoweb.vimrobots.vimrpcgen.vimrpl.vimrst.vimrtf.vimruby.vimsamba.vimsas.vimsather.vimscheme.vimscilab.vimscreen.vimsdl.vimsed.vimsendpr.vimsensors.vimservices.vimsetserial.vimsgml.vimsgmldecl.vimsgmllnx.vimsakIU@m> - 4.2.6-4James Antill <jantill@redhat.com> - 4.2.6-3James Antill <jantill@redhat.com> - 4.2.6-2Christopher Aillon <caillon@redhat.com> - 4.2.6-1Jesse Keating <jkeating@redhat.com> - 4.2.5-2Jesse Keating <jkeating@redhat.com> - 4.2.5-1.2.2Jesse Keating <jkeating@redhat.com> - 4.2.5-1.2.1Jesse Keating <jkeating@redhat.com> 0 4.2.5-1.2Jesse Keating <jkeating@redhat.com>Colin Walters <walters@redhat.com> - 4.2.5-1Colin Walters <walters@redhat.com> - 4.2.1-3Colin Walters <walters@redhat.com> - 4.2.1-2Colin Walters <walters@redhat.com> - 4.2.1-1Jens Petersen <petersen@redhat.com> - 4.2.0-3Elliot Lee <sopwith@redhat.com>Jens Petersen <petersen@redhat.com> - 4.2.0-1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Jens Petersen <petersen@redhat.com> - 4.0.9-1Jens Petersen <petersen@redhat.com> - 4.0.7-3Jens Petersen <petersen@redhat.com> - 4.0.7-2Jens Petersen <petersen@redhat.com> - 4.0.7-1Elliot Lee <sopwith@redhat.com>Jens Petersen <petersen@redhat.com> - 4.0.6-7Jens Petersen <petersen@redhat.com> - 4.0.6-5Tim Powers <timp@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de> 4.0.6-2Jens Petersen <petersen@redhat.com> 4.0.6-1Jens Petersen <petersen@redhat.com>Jens Petersen <petersen@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 4.0.4-8Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 4.0.4-5Trond Eivind Glomsrød <teg@redhat.com> 4.0.4-4Trond Eivind Glomsrød <teg@redhat.com> 4.0.4-3Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 4.0.4-1Trond Eivind Glomsrød <teg@redhat.com> 4.0.3-1Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Preston Brown <pbrown@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Michael Maher <mike@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Michael Fulbright <msf@redhat.com>- signal safety when updating global state (#886926)- Fix infinate loop when checking script syntax.
- Resolves: rhbz#813219- Parser error attempts to execute assignment expressions (memset).
- Resolves: rhbz#758681- Parser error attempts to execute assignment expressions.
- Resolves: rhbz#758681
- Subversion completion broken.
- Resolves: rhbz#788050- Queue signals before fork.
- Resolves: rhbz#733582
- Fix deadlock for terminated suspended jobs.
- Resolves: rhbz#706029
- Allow greater than 3 commands to use a completion service.
- Resolves: rhbz#700722- Fix ksh emulation problem when doign syntax only checking.
- Resolves: rhbz#488943- Fix crash when searching history.
- Resolves: rhbz#610505- Fix reused pids bug
- Resolves: rhbz#465455
- Fix comments in $() edge case syntax parsing error
- Resolves: rhbz#484348- Add --enable-maildir-support BZ#186281- Update to 4.2.6- rebuild
- add mising br texi2html- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc ckp@PePePePdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePePdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPePePePdPdPcPePePePcPePePePePePePcPePePePePcPePePePePePePePePePePePcPePePePePbPbPbPcPcPcPcPcPcPcPcPcPcPcPcPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPcPcPcPcPcPcPcPcPcPcPbPcPbPcPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPbPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPcPePcPcPcPcPePePePePePcPcPcPePcPcPePcPePePePcPcPePcPcPePcPePcPcPcPcPcPcPb2b81d91c540af772b554c6d363eff0bbe05883d47c77bf360a7a42b0e25913f87ac072c771eb91e828e0ea38f11d6e2c2954e9cf1082d32a573578c856654badc8dbd32c82e91790c9953d346fcbb44ef4ca04781dfd28d08d43d005a696d4f1ae063c26751fbc9cf309efa8f335608d20f42a34d15d781eab0a4c20ccf417fd5f13437752c0d286ee600f9816c6d6faec6bd4668d6879ffde458073809cde23c603e2a0b7c24bf0ac071123a9a8dadc02159b55c2abf2ed42bc4d35ee1d8f6417af8c01dbac65835d494f866b5ba20512c0ca2136a6f2c109b6e75c195156d1b6d4065b657e9b6b941bfca63aa6a90b8a2a4e904f7765a359710acdd9a5d78cff39a430285587cccdf814054e42f6cd20f42a34d15d781eab0a4c20ccf417fd5f13437752c0d286ee600f9816c6d6faec6bd4668d6879ffde458073809cde23c603e2a0b7c24bf0ac071123a9a8dadc02159b55c2abf2ed42bc4d35ee1d8f648eece406873239d0ce0a8b3d3#l 0@ 00	ASCII textELF 64-bit LSB executable, AMD x86-64, version 1 (SYSV), for GNU/Linux 2.6.9, dynamically linked (uses shared libs), strippedPNG image data, 192 x 192, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 72 x 72, 8-bit/color RGBA, non-interlacedUTF-8 Unicode C program textXML document textdirectorysymbolic link to `yelp'=R
RRRRRRRRRRRRRRRRRR R!R"R#R$R%R&R(R)R*R+R-R.R/R0R1R3R4R5R6R7R8R9R:R;R<R=R>R?R@RARBRCRDRERFRGRIRJRLRMRNRQ?	>O0"Kf4MW?Q$AGV(KUbb$R#Ԉَ
85MQz؈?Q$AGV(ILSe{N":XQ['d!>2?;942b9db2890589282dbb0fc92957081343ac0e34\=H  \<E>.5ECR(Z/]'o*p8q2s*t/u-x5|-,E.#5E`(k(uy&%>059/!/usr/share/locale/ms/LC_MESSAGES/bM/usr/share/locale/ms/+0-4"K0+724)B'E/M.f,0,-0'.+.+2)+,8.5/698I%L$MP0D=-5DCR'Z.]&o)p7q1s)t.u,x4|,+D-"5D`'k'y%$=/48./!/usr/share/locale/mr/LC_MESSAGES/a/usr/share/locale/mr/`/usr/share/locale/mos/_/usr/share/locale/moh/^/usr/share/locale/mo/]/usr/share/locale/mno/\/usr/share/locale/mni/[/usr/share/locale/mnc/8.-/9-K/2/*/61%64(f+/+,2/-)*,7-3.4/597P/C5C?p6y,C5Cdl7/!/usr/share/locale/mn/LC_MESSAGES/k`@150331599770558c8e4f8be2b4192779b26d54ff0334f14bda5783263a4db86e07b5cab3e3d77ba575bcb4075cb768b50d694a770c4ee9ef8ec473c0a9272c724de81e6023133fd55a1f6f335bcfbc968d98d02a5d469c3f42c02871deb0d63f6f5137a483756f0bafc12ec658a2e4481b23f176693b39a9e90775824633b66df3a89ce8ee02138e73db348ac86a93a7ac484f8a9591dee1a695ad5ac8060372e4771dba1ad79e483347647ca931a19e83598657e6b89b49ea8a467ac1a426a2583710f26ef4f37a4539486d9c7a8ff8be49dcadee2fbac3db70ad0dcb95e79af87d03d732a9f87624bf7453358491e878cb558e74a9e6c693930c799332004c51d9d34359f78145770c9e6277a3d026627bc0a764e5c582fbdc65638e3652d597148441b0a263c1500934948f608e69751389530380e22c32d8d5eae6d226e4956823bf5d587f459975f67dbd572ec980c0d1f7df3c94ba2075233d8be9502b84658cde2bc6ca897a4b7ad06b199d6f0aeb2e3bd63055b8deec596c2d0ec5c49fdb990958e8062af0640ffac79f735c1fcee700d48148628ec6775b613fa4c420719a72cb5264d895789b06c3be1541892f8f76a2091e335b5df2933323706b66c402445e9838e466c853e58ebd8d229c7fbce2810ec4590ae64569dc0defacfb436a4f504288df84071534162cce08861f8078623af4e33e52a8333a70dc7fcfd45e4279bf57700286edecce89b257ddfe55ff3ae679cd47c6be5228b364a8c77e62c5b9c5a0c51016a8d692460c727edbc0bae866b5473b32a4ff448271118fa0564ccef42a62ed096690f5a266109601fe9979c64fe33ce2120be3a9682399901d07a4bb385321aa7731db0b4510d30454e8a8eb55a777694c253df990202a9c3ddaac11c25bc135402af680049228812243aabfa07637ede06f3fa9ce0c8737976acd012c28926dcf88ea550ac8bf7d017c1a977788344376bb0cf4f3be8b865834913fa1711c253265fd7ff3cb48d63fa2cd375e316a064dbb7170ad218d4889ea623cb988553eeb989996c3fd4a994f19b3706dcbb12884a64037b8fa4337491b1acd0776d13cedad18c0b1cea167ac3b63f1becafea5be5f8799b8640ac98453eb285a250a473075359564e98217714ab0c33f5ed59389495135bebb2ca6b5d2221af501b3533cca6c9bd9a6c93ab32511239b15356a09075c20629425dff98d3c1bb714e8aa65f6a4f8e1a91ef3dad3e8b90aefed13d42816e72e0dff449f9a284925e89ec436bb03c7205d39baad360ecf6619c46544ef64e8f27eeeee24bd7c5f78bf042d8c496b1e983a0a77f7bfc0e8f937ada5a618ffda91ff442d40fff990d1991aead72bdbd92e86c8c492fff46e6d3945a28dc472b7c49efa44a8f6eb994967d42cf27f04f2d01535291deeca26cbfd1781952bd109ce80fb9bdb92868755f52e35a5700aa34fb43806f97c3214df0b8c642c803e9e603d858c668ebeff7aa66cabc97e8fd212e1cfc827dbe44f47ef564b95315598b3ddc56508aace5d8f8002c92f41e976a75786d8f9ae6754d03acba835355e625178e7850c6d4fcd20f343099f194c04f8d1832d77b7dc8a512baaf473b4854f9f4074d789731df8008c937ea9078451101470b0ce796b75c85482911f6033a4be42f6e35ac52d0ab169ece156dce24656f9a4e70e077498f7e0e8d1a0cd7fa00ced643ee624cf75f66bacd8ef48be36f6d0a2b4f35589e43e172f32fa8c3b049054eb80e8eeb9961e2f2690791eca23a5af3428950dd0099f3356f40254a843d0ba4d39f630e0690ecbecf84fa09b65f6af91a69c61fa2efdafb35136e653eff61c42b79d1fdc2aa6933c8bbe0a58eb9d7ee64dc7cb6ed61fd09fc1397e506f85f7e9a38fabdb5a4f606d4b024912061e3da977a39fb8c7574b7bf3aaab56136bcb43e90eb6ac39c177362368438b2098366e26b2923f750e70afab6e1086f94cd485e5bc01c0ed49cf824781c4fcd9981701dd8098d3d8371a709a1e6e207956580f679245f72c49a0918ed278c40a00df52ad14342105f371dfe63629609509247f21c39b4ea3cd8996ccb84b1a0bed8b1eba43fa70027ce3f8730eec6f43b9527d3bd8d0ae60c4565d15b0c0cba680cabbcb2f883e47542702c783c74ea807a4a0416729fec682f294e04862a119ea3a8df9f70fc8828411b61b5b70b601ef7526c549580e3b5ae7af6d0e26b31a492b473429edb2421ea7588a151916b13cb12b7d79b55078af38ca7e0ea3601b060bf756ce482db12fb9795784b5cec0cbdf68a71eb6475320246c18fe8cf6f75dbc8fdc76f69f237027d6f438cea925a338540195d5c8dfc8cffcaa03bbbd3679c6125eca95335a3fa1785a64cb9c2a9eced090d224dc47db7b7bd1741ab086a1a41ce05013eb6fa78dfc681cce75eadd7e1a7f4c0597a7a8f854d4e8206dffa6728aa62412c5bcff09da4b967611b8275c610f46647ffdf2db7ec1a115b5b62c7ad7426c592a7bd3f75a744144114d084fb99ce57a6f8ce64b56657e89a803f2905caa87417f7dc667a827004e0e193fc6593f2287e47c82a7fbc6bfec4a467f8b8550455312954bf6e90ae95cffa0419039ebd2c576ee7f9b2c3d10e853f4a4640eb510d7711e06a9806e7d4f620f2f28630912f37643868e02e1db04758469beed725ff6ca7a5cade4e1a486dd9138fae0657d99e1a654f693ddfbb1233fde0a7ad63531da2815336b769882fa58bf5974054771106eb4f54a913937c1092e9f8698386662kC3-@3-2-X-Od1sOUs(qtF9736c9c99580ae30cf43c518d04ca434f88dc24a\=$Sd/usr\<B1(U(nQ0Gc_jEMU(nQ0Gc_jEM!Jn_Q}|j8£eGOR:$ZӋJ3f3#?)`פPb?ӏ!rT(,ısRdim1-	]*{:+K ů[Q~Q2MdN_b[0PJ&em**: 80OӧYXq!!!N!RSE1>na:	@}Va*]'Ihȶ"ݧ`Vw3wؿDLΊZlZwj帪iQxxm>.;&m}rJJE"!!rnD@X|l
O^~I=)?)0g
"e~!+2A|DBTyD%A{)uFG	Eag'	]]NN	'|^V['*V:sb)<0	@R0U4W(]K!AbE]LGjpdkf-k-t-+ !A^@
-HffttB*^̬33*AkU$GbF	ntrrچ;)ɯ>iB''GjrEuSva{M,1u_vF́ikpZV5)i`H9Zh_VV軾 tlp}2vMU;C2ETtC40g2p?"eQz|h9HH@|ӟ| 8ԷUU\\SSǕm]C UG\G
'[ JU\jfa(p/ӞU\|=tj*
afS0r;hAYCqsk}6mXYe\7mu`lYl lfXꚥvYibE
YE
W
%nEN-	Y		>ኖ^[YV"QoSYncYS,K/aYWuZ_c{ݲ7`w<aUq.Nm$՚#1ll`L_IŃ FFo]*+:h

w<9Z,3[?AH
,Z$[]zّ8<d6<!kO'ZiB+Sl {O۷sNړĀ;QS|oj&Jq\XIQP	dFl+hUF,"=A$P23YqwYRUrj2]r55
^Q$-&BK_$ŝǬyNOBBtȹ
Oh9d9r99.9cR~&Jaųϋx`!qddcGr"=ncnm:mI
LSd4s`
&tǏpF#VA;&ځ;a֝P˶&	83;Ti&&洲2'd8^&D	pw]C&|9+IL(*
PG.[[7oK_.Iڜd'.UU Ti<m+Rz.rrGѴDXA8v$
J
Ma
@t9	p&Idzx6/sk|,

qCk9-էhJmu,`USz}fO`?_ʰt8L
h-i灳qv6򱆁?acpڪ̿Ylj/ohic.+a|HF^DH|zu.>zq9=C~D
>yL~[=KcKJ:J*d٭^,{W:_M?͂$ڤzV>M#X*oн9F"\ÞG"'Fr6Q'^5zk]*^B-/[g`ծ XakKa&F@N`&&FF%r<qI+bi|&&FF_,>d/O?j\/yPYυ_aKUhqFjpSP@ Picht ) [447316]
- [s390] zfcp: fix check for handles in abort handler (Hans-Joachim Picht ) [447331]
- [s390] aes_s390 decrypt may produce wrong results in CBC (Hans-Joachim Picht ) [446191]
- [s390x] CPU Node Affinity (Hans-Joachim Picht ) [447379]
- [gfs2] inode indirect buffer corruption (Bob Peterson ) [345401]
- [s390] cio: avoid machine check vs. not operational race (Hans-Joachim Picht ) [444082]
- [s390] qeth: avoid inconsistent lock state for inet6_dev (Hans-Joachim Picht ) [444077]
- [s390] qdio: missed inb. traffic with online FCP devices (Hans-Joachim Picht ) [444146]
- [s390] qeth: eddp skb buff problem running EDDP guestlan (Hans-Joachim Picht ) [444014]
- [s390] cio: kernel panic in cm_enable processing (Hans-Joachim Picht ) [442032]
- [fs] fix bad unlock_page in pip_to_file() error path (Larry Woodman ) [439917]
- [s390] zfcp: Enhanced Trace Facility (Hans-Joachim Picht ) [439482]
- [s390] dasd: add support for system information messages (Hans-Joachim Picht ) [439441]
- [s390] zcrypt: add support for large random numbers (Hans-Joachim Picht ) [439440]
- [s390] qeth: recovery problems with failing STARTLAN (Hans-Joachim Picht ) [440420]
- [s390] qdio: change in timeout handling during establish (Hans-Joachim Picht ) [440421]
- [s390] lcs: ccl-seq. numbers required for prot. 802.2 (Hans-Joachim Picht ) [440416]
- [s390] dasd: diff z/VM minidisks need a unique UID (Hans-Joachim Picht ) [440402]
- [s390] qeth: ccl-seq. numbers req for protocol 802.2 (Hans-Joachim Picht ) [440227]
- [s390] sclp: prevent console lockup during SE warmstart (Hans-Joachim Picht ) [436967]
- [s390] zcrypt: disable ap polling thread per default (Hans-Joachim Picht ) [435161]
- [s390] zfcp: hold lock on port/unit handle for task cmd (Hans-Joachim Picht ) [434959]
- [s390] zfcp: hold lock on port handle for ELS command (Hans-Joachim Picht ) [434955]
- [s390] zfcp: hold lock on port/unit handle for FCP cmd (Hans-Joachim Picht ) [433537]
- [s390] zfcp: hold lock when checking port/unit handle (Hans-Joachim Picht ) [434953]
- [s390] zfcp: handling of boxed port after physical close (Hans-Joachim Picht ) [434801]
- [s390] dasd: fix ifcc handling (Hans-Joachim Picht ) [431592]
- [s390] cio: introduce timed recovery procedure (Hans-Joachim Picht ) [430593]
- [s390] cio: sense id works with partial hw response (Hans-Joachim Picht ) [430787]
- [s390] zfcp: fix use after free bug (Hans-Joachim Picht ) [412881]
- [s390] cio: add missing reprobe loop end statement (Hans-Joachim Picht ) [412891]
- [s390] zfcp: imbalance in erp_ready_sem usage (Hans-Joachim Picht ) [412831]
- [s390] zfcp: zfcp_erp_action_dismiss will ignore actions (Hans-Joachim Picht ) [409091]
- [s390] zfcp: Units are reported as BOXED (Hans-Joachim Picht ) [412851]
- [s390] zfcp: Reduce flood on hba trace (Hans-Joachim Picht ) [415951]
- [s390] zfcp: Deadlock when adding invalid LUN (Hans-Joachim Picht ) [412841]
- [s390] pav alias disks not detected on lpar (Hans-Joachim Picht ) [416081]- [net] randomize udp port allocation (Eugene Teo ) [454572]
- [tty] add NULL pointer checks (Aristeu Rozanski ) [453154]
- [misc] ttyS1 lost interrupt, stops transmitting v2 (Brian Maly ) [451157]
- [net] sctp: make sure sctp_addr does not overflow (David S. Miller ) [452483]
- [sys] sys_setrlimit: prevent setting RLIMIT_CPU to 0 (Neil Horman ) [437122]
- [net] sit: exploitable remote memory leak (Jiri Pirko ) [446039]
- [x86_64] zero the output of string inst on exception (Jiri Pirko ) [451276] {CVE-2008-2729}
- [net] dccp: sanity check feature length (Anton Arapov ) [447396] {CVE-2008-2358}
- [misc] buffer overflow in ASN.1 parsing routines (Anton Arapov ) [444465] {CVE-2008-1673}
- [x86_64] write system call vulnerability (Anton Arapov ) [433945] {CVE-2008-0598}- [net] Fixing bonding rtnl_lock screwups (Fabio Olive Leite ) [450219]
- [x86_64]: extend MCE banks support for Dunnington, Nehalem (Prarit Bhargava ) [446673]
- [nfs] address nfs rewrite performance regression in RHEL5 (Eric Sandeen ) [436004]
- [mm] Make mmap() with PROT_WRITE on RHEL5 (Larry WoodmanjPUx6@HEL 5.6 (Chad Dupuis) [567428]
- [scsi] qla2xxx: update to 8.03.01.05.05.06-k (Chad Dupuis) [567428]
- [xen] correct bitsize calculation for 32-on-64 (Andrew Jones) [616827]- [net] r8169: fix for broken register writes (Ivan Vecera) [581654]
- [serial] remove contact info for ite887x chip support (Dean Nelson) [563271]
- [serial] fix modpost warning in ite887x driver (Dean Nelson) [563271]
- [serial] add support for ite887x chips (Dean Nelson) [563271]
- [parport] increase ite887x's I/O port range (Dean Nelson) [563271]
- [scsi] qla2xxx: update firmware to version 5.03.02 (Chad Dupuis) [578444 598946]
- [fs] cifs: reject DNS upcall add_key req from userspace (Jeff Layton) [612171] {CVE-2010-2524}
- [security] keys: new key flag for add_key from userspace (Jeff Layton) [612171] {CVE-2010-2524}- [fs] gfs2: fix rename causing kernel oops (Robert S Peterson) [602025]
- [misc] io_apic: skip timer_irq_works check when on VMware (Prarit Bhargava) [575309]
- [scsi] be2iscsi: fix for 64k data length sge (Mike Christie) [608801]
- [mm] fix excessive memory reclaim from zones w/lots free (Larry Woodman) [604779]
- [mm] properly release all hugepages on database shutdown (Larry Woodman) [593131]
- [net] fix accept_local handling for dev with no xattrs (Jiri Olsa) [601370]
- [fs] nfs: i_nlinks changes must set NFS_INO_INVALID_ATTR (Jeff Layton) [601800]
- [fs] nfs: fix resolution in nfs_inode_attrs_need_update (Jeff Layton) [601800]
- [fs] nfs: fix compiler warnings introduced recently (Jeff Layton) [601800]
- [fs] nfs: fix attribute updates even more (Jeff Layton) [601800]
- [fs] nfs: fix the NFS attribute update (Jeff Layton) [601800]
- [fs] nfs: clean up inode handling functions (Jeff Layton) [601800]
- [fs] nfs: nfs_refresh_inode should clear cache_validity (Jeff Layton) [601800]
- [fs] nfs: use nfs_refresh_inode in __nfs_revalidate_inode (Jeff Layton) [601800]
- [ata] ahci, pata_marvell: fixup competition for PATA port (David Milburn) [237372]
- [net] qlcnic: Add QLCNIC to Kconfig and Makefile (Chad Dupuis) [562723]
- [net] qlcnic: enable building driver module (Chad Dupuis) [562723]
- [net] qlcnic: remove extra space from board names (Chad Dupuis) [562723]
- [net] qlcnic: fix bios version check (Chad Dupuis) [562723]
- [net] qlcnic: validate unified fw image (Chad Dupuis) [562723]
- [net] qlcnic: fix multicast handling (Chad Dupuis) [562723]
- [net] qlcnic: additional driver statistics. (Chad Dupuis) [562723]
- [net] qlcnic: fix tx csum status (Chad Dupuis) [562723]
- [net] qlcnic: add loopback diagnostic test (Chad Dupuis) [562723]
- [net] qlcnic: add interrupt diagnostic test (Chad Dupuis) [562723]
- [net] qlcnic: support LED blink for device identification (Chad Dupuis) [562723]
- [net] qlcnic: protect resoruce cleanup by rtnl lock (Chad Dupuis) [562723]
- [net] qlcnic: clear device reset state after fw recovery (Chad Dupuis) [562723]
- [net] qlcnic: add ethernet identifier in board info (Chad Dupuis) [562723]
- [net] qlcnic: use DEFINE_PCI_DEVICE_TABLE (Chad Dupuis) [562723]
- [net] qlcnic: add Qlogic ethernet driver for CNA devices (Chad Dupuis) [562723]
- Revert: [fs] cifs: reject DNS upcall add_key req from userspace (Jeff Layton) [612171] {CVE-2010-2524}
- Revert: [security] keys: new key flag for add_key from userspace (Jeff Layton) [612171] {CVE-2010-2524}- [usb] uhci: fix oops in uhci_scan_schedule (Pete Zaitcev) [516851]
- [wireless] rtl818x: use cancel_work_sync (Stanislaw Gruszka) [582191]
- [wireless] iwlwifi: use cancel_work_sync (Stanislaw Gruszka) [582191]
- [wireless] ath9k: use cancel_work_sync (Stanislaw Gruszka) [582191]
- [wireless] rt2x00: use cancel_work_sync (Stanislaw Gruszka) [582191]
- Revert: [wireless] rt2x00: fix work cancel race condition (Stanislaw Gruszka) [582191]
- [wireless] use cancel_work_sync in mac80211 and core (Stanislaw Gruszka) [582191]
- [misc] workqueue: add cancel_work_sync to include (Stanislaw Gruszka) [582191]
- [net] igb: drop support for UDP hashing w/ RSS (Stefan Assmann) [613780]
- [misc] signals: avoid unnecessary credentials check (Oleg NestekY ,-@,-+---326ab095f0fe65b38bb8fe9511243085d53cc5f11236a8a3d0820fc3dc6683c7ebc7f20067ff81d084115562ded953a9def49d52464ec13da476376cc279be1ca9a32abba044d97cb696ea0c3753e8390d062e8865fd6bdfe887e587f5b1363eabdc48413600d80e9ac652a74d46f8c3e1caa26c19732b2a964c3412d6e723b00d1669383daccea8c82a4a79b9ef9e92efd1e5a49b4694ed343fb4042ce500ca9fe9a602cf444f917d569ef7e88a6fa22c818a178b522d51eb4ef1b1665e08fd1c43e44f311367bb452147ebc727baaafbd366bfddcf544aebd7e6d206d73850d77d305ab548f957a7b180ebf583ed0c315d70d6a4890f792f07d9272deb4ae870ca6821117877fa81223920889f5a8e47e0efe6977b8bfclibxml2.so.2.6.26rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrok[@ib-dicts location will not be correctly detected without 
  that package being installed, add buildreq for cracklib-dicts.
- Add patch57: makes configure use $LIBNAME when searching for cracklib 
  dicts, and error out if not found.- Fixed pam config files- Added fix to install libs in correct directory on 64bit machine- pam_timestamp_check: check that stdio descriptors are open before we're
  invoked
- add missing chroot.conf- pam_timestamp: sundry fixes, use "unknown" as the tty when none is found- pam_timestamp_check: be as smart about figuring out the tty as the module is- pam_timestamp_check: remove extra unlink() call spotted by Havoc- pam_timestamp: chown intermediate directories when creating them
- pam_timestamp_check: add -d flag to poll- pam_timestamp: add some sanity checks
- pam_timestamp_check: add- pam_timestamp: add a 'verbose' option- rebuild with db4
- just bundle install-sh into the source package- pam_unix: be more compatible with AIX-style shadowing (#19236)- libpam_misc: fix possible infinite loop in misc_conv (#62195)
- pam_xauth: fix cases where DISPLAY is "localhost:screen" and the xauth
  key is actually stored using the system's hostname (#61524)- rebuild- rebuild- include the pwdb config file- adjust the pwdb-static patch to build pam_radius correctly (#59408)- change the db4-devel build dependency to db3-devel- rebuild- pam_unix: log successful password changes
- remove pam_timestamp- fix pwdb embedding
- add pam_timestamp- swallow up pwdb 0.61.1 for building pam_pwdb- pam_userdb: build with db4 instead of db3- pam_stack: fix some memory leaks (reported by Fernando Trias)
- pam_chroot: integrate Owl patch to report the more common causes of failures- fix a bug in the getpwnam_r wrapper which sometimes resulted in false
  positives for non-existent users- include libpamc in the pam package (#55651)- pam_xauth: don't free a string after passing it to putenv()- pam_xauth: always return PAM_SUCCESS or PAM_SESSION_ERR instead of PAM_IGNORE,
  matching the previous behavior (libpam treats PAM_IGNORE from a single module
  in a stack as a session error, leading to false error messages if we just
  return PAM_IGNORE for all cases)- reorder patches so that the reentrancy patch is applied last -- we never
  came to a consensus on how to guard against the bugs in calling applications
  which this sort of change addresses, and having them last allows for dropping
  in a better strategy for addressing this later on- pam_rhosts: allow "+hostname" as a synonym for "hostname" to jive better
  with the hosts.equiv(5) man page
- use the automake install-sh instead of the autoconf install-sh, which
  disappeared somewhere between 2.50 and now- add pwdb as a buildprereq- pam_tally: don't try to read past the end of faillog -- it probably contains
  garbage, which if written into the file later on will confuse /usr/bin/faillog- pam_limits: don't just return if the user is root -- we'll want to set the
  priority (it could be negative to elevate root's sessions)
- pam_issue: fix off-by-one error allocating space for the prompt string- pam_mkhomedir: recurse into subdirectories properly
- pam_mkhomedir: handle symlinks
- pam_mkhomedir: skip over special items in the skeleton directory- add cracklib as a buildprereq
- pam_wheel: don't ignore out if the user is attempting to switch to a
  unprivileged user (this lets pam_wheel do its thing when users attempt
  to get to system accounts or accounts of other unprivileged users)- pam_xauth: close a possible DoS due to use of dotlock-style locking in
  world-writable directories by relocating the temporary file to the target
  user's home directory
- general: include headers local to this tree using relative paths so that
  system headers for PAM won't be pulled in, in case include paths don't
  take care of it- pam_xauth: rewrite to skip refcounting and just use a temporary file
  created using mkstemp() in /tmp- pam_userdb: fix the key_only flag so that the null-terminator of the
  user-password string isn'kP,@,,D_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:locale_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_tsystem_u:object_r:man_t?`"4qE8	pm"?P!]GV( FTL@NaPirr|Ρ1?P!]GV(Ơh:GiDmBph?Vt).+,fe4504696dd268525b43c51e074c5bc77cc3aba5\=`\<pcm__ioplug_8h-source.html/_2test_2pcm_8c-example.html&2>Narp.8.gzlibpangoxft-1.0.so.0.1400.9(RME9636.conf,sgB.2images..db_get_mpf.html compat_workarounds.hpp'""'libresolv.soK]libogg-1.1.3&	F	xnuppc&Fwren&Frca&Fnec5520&Fkonsole-linux&Fguru-24.G>PNGinstall.html79glibc_post_upgrade.i6867INIS-8.so77=nosegneg5 ipc.5.gz5pts.4.gz5null.4.gz5wcrtomb.3p.gz5Sstrrchr.3p.gz5
setgrent.3p.gz5
roundf.3p.gz5W
pthread_condattr_getpshared.3p.gz5
posix_trace_eventset_add.3p.gz5	optind.3p.gz5	nexttoward.3p.gz5	munlockaEnsIDOMHTMLParamElement.hEnsIDOMDOMConfiguration.hEnsICache.hEpnsEventDispatcher.hBDialupDruid.pyBsystem-control-networkAaAbAcsystem-config-date.8.gzAAAdateconfig@glibgnomeui-gnome-app-util.html@flibgnomeui-gnome-app-hel#(h#(h(~(#(h(~((################*07;=Ei'iRiajj%m nppp1qq`+O+OO016GI&JRUhU~UUU&U6UUUUQUUYU&UUUU!U4UUUU
Y]ee%e<eFeJf\k]oooo-rhxyyz}~\h\~\\\&\6\\\\Q\\Y\&\\\\!\4\\\\
___init__.pyc"3:Z	'ZFZZ=6Y'
 L
N#}~1
L
S#includeKItime_system_counted.hpp&atoll.3.gzKIcons_iteratorglLightf.3gl.gzrpcclientstubs-64.hpango-glyph-item.hBytecode.pmn
DRSA_verify_ASN1_OCTET_STRING.3ssl.gzk|@om> 7.0.109-3.5Karsten Hopp <karsten@redhat.de> 7.0.109-3.4Karsten Hopp <karsten@redhat.de> 7.0.109-3.3Karsten Hopp <karsten@redhat.com> 7.0.109-3.2Karsten Hopp <karsten@redhat.com> 7.0.109-3.1Jeremy Katz <katzj@redhat.com> - 7.0.109-3Karsten Hopp <karsten@redhat.com> 7.0.109-2Karsten Hopp <karsten@redhat.com> 7.0.109-1Karsten Hopp <karsten@redhat.com> 7.0.100-1Karsten Hopp <karsten@redhat.de> 7.0.099-1Karsten Hopp <karsten@redhat.de> 7.0.086-1Karsten Hopp <karsten@redhat.de> 7.0.083-1Karsten Hopp <karsten@redhat.de> 7.0.076-1Karsten Hopp <karsten@redhat.de> 7.0.066-2Karsten Hopp <karsten@redhat.de> 7.0.066-1Karsten Hopp <karsten@redhat.de> 7.0.063-1Karsten Hopp <karsten@redhat.de> 7.0.053-1Karsten Hopp <karsten@redhat.de> 7.0.050-1Karsten Hopp <karsten@redhat.de> 7.0.042-2Karsten Hopp <karsten@redhat.de> 7.0.042-1Karsten Hopp <karsten@redhat.de> 7.0.039-1Jesse Keating <jkeating@redhat.com> - 2:7.0.035-1.1Karsten Hopp <karsten@redhat.de> 7.0.035-1Karsten Hopp <karsten@redhat.de> 7.0.022-2Karsten Hopp <karsten@redhat.de> 7.0.022-1Karsten Hopp <karsten@redhat.de> 7.0.020-1Karsten Hopp <karsten@redhat.de> 7.0.019-1Karsten Hopp <karsten@redhat.de> 7.0.017-1Karsten Hopp <karsten@redhat.de> 7.0.016-1Karsten Hopp <karsten@redhat.de> 7.0.012-1Karsten Hopp <karsten@redhat.de> 7.0.010-1Karsten Hopp <karsten@redhat.de> 7.0.005-2Karsten Hopp <karsten@redhat.de> 7.0.000-2Karsten Hopp <karsten@redhat.de> 7.0.000-1Karsten Hopp <karsten@redhat.de> 7.0.g001-1Karsten Hopp <karsten@redhat.de> 7.0.f001-1Karsten Hopp <karsten@redhat.de> 7.0.e001-1Karsten Hopp <karsten@redhat.de> 7.0.d001-1Karsten Hopp <karsten@redhat.de> 7.0c.000-3Karsten Hopp <karsten@redhat.de> 7.0c.000-2Karsten Hopp <karsten@redhat.de> 7.0c.000-1Karsten Hopp <karsten@redhat.de> 7.0aa.000-3Karsten Hopp <karsten@redhat.de> 7.0aa.000-2Karsten Hopp <karsten@redhat.de> 7.0aa.000-1- remove obsolete 'e' in front of filenames (netrw.vim)
  rhbz #591578
- fix recursive function call when doing completion
  rhbz #681108- fix directory listing (vim ..) (rhbz #652610)- move gvim desktop entry to Accessories (#506442)
- redo several patches so that they apply with fuzz=0
- fix syntax error when a script contains \c (#512265)
- fix end of line error in ex mode comments (#572157)- fix release
- fix file delete in netrw (#505344)- fix vim.sh profile- fix vim.csh profile
- link with libncurses instead of libtermcap
- provide correct number of parameters to [ builtin when 'id -u' returns
  an empty string
- group autocmds provided by Red Hat into a redhat augroup so that they 
  can be cleanly removed- add patch 7.0.236 to fix memory calculation- fixes CVE-2008-3074 (tar plugin)
- fixes CVE-2008-3075 (zip plugin)
- fixes CVE-2008-3076 (netrw plugin)
- fixes CVE-2008-4101 (keyword and tag lookup)- another fix for CVE-2008-2712- fix release- re-enable debuginfo- update netrw files for CVE-2008-2712- add fixes for CVE-2007-2953 and CVE-2008-2712- use gzip -9n to avoid multilib fileconflicts- Let 'modeline' default to off for root
- Resolves: bz#238259- fix modeline issues
- Resolves: bz#238259- disable vim-spell subpackage as it pushes us over CD boundaries- fix typo in vimspell.sh (#203178)- update to patchlevel 109 to fix some redraw problems
- fix invisible comments in diff mode (#204042)- Patchlevel 100
- replace runtime files with newer ones- Patchlevel 99- Patchlevel 86- Patchlevel 83- Patchlevel 76- fix vimdiff colors (#204042)- fix syntax patch (#203798)
- patchlevel 66- Patchlevel 63- Patchlevel 53
- Buildrequires libXpm-devel- Patchlevel 50- clean up spec file- patchlevel 42- patchlevel 39
- allow usage of $VIM variable (#199465)- rebuild- patchlevel 35- add binfmt_misc rpc_pipefs to fstypes for better mtab highlighting- patchlevel 22- patchlevel 20- patchlevel 19
- buildrequire autoconf- patchlevel 17, although it affects just the Motif version
- own some directories (#192787)- patchlevel 016- patchlevel 012- patchlevel 010- patchlevel 005
- move older changelogs (<7.0) ij@@]
- [char] add hp-ilo driver (Tony Camuso ) [437212]
- [net] do liberal tracking for picked up connections (Anton Arapov ) [448328]
- [scsi] BusLogic: typedef bool to boolean for compiler (Chip Coldwell ) [445095]
- [misc] ioc4: fixes - pci_put_dev, printks, mem resource (Jonathan Lim ) [442424]- [net] slow_start_after_idle influences cwnd validation (Thomas Graf ) [448918]
- [dlm] fix a couple of races (David Teigland ) [457569]
- [net] NetXen driver update to 3.4.18 (Ed Pollard ) [443619]
- [mm] NUMA: system is slow when over-committing memory (Larry Woodman ) [457264]
- [net] ixgbe: remove device ID for unsupported device (Andy Gospodarek ) [454910]
- [ppc] Event Queue overflow on eHCA adapters (Brad Peters ) [446713]
- [ppc] IOMMU Performance Enhancements (Brad Peters ) [439469]
- [ppc] RAS update for Cell (Brad Peters ) [313731]
- [ppc] fast little endian implementation for System p AVE (Brad Peters ) [439505]
- [net] proc: add unresolved discards stat to ndisc_cache (Neil Horman ) [456732]
- [x86_64] ia32: increase stack size (Larry Woodman ) [442331]
- [mm] fix PAE pmd_bad bootup warning (Larry Woodman ) [455434]
- [video] add uvcvideo module (Jay Fenlason ) [439899]
- [crypto] add tests for cipher types to self test module (Neil Horman ) [446514]
- [mm] fix debug printks in page_remove_rmap() (Larry Woodman ) [457458]
- [mm] fix /proc/sys/vm/lowmem_reserve_ratio (Larry Woodman ) [457471]
- [xen] add VPS sync read/write according to spec (Bill Burns ) [437096]
- [xen] use VPS service to take place of PAL call (Bill Burns ) [437096]
- [xen] enable serial console for new ia64 chip (Bill Burns ) [437096]- [ipmi] restrict keyboard I/O port reservation (peterm@redhat.com ) [456300]
- [mm] xpmem: inhibit page swapping under heavy mem use (George Beshers ) [456574]
- [fs] vfs: wrong error code on interrupted close syscalls (Jeff Layton ) [455729]
- [misc] don't randomize when no randomize personality set (Bryn M. Reeves ) [444611]
- [ia64] holdoffs in sn_ack_irq when running latency tests (Jonathan Lim ) [447838]
- [xen] x86: new vcpu_op call to get physical CPU identity (Bhavana Nagendra ) [434548]
- [xen] HV: memory corruption with large number of cpus (Chris Lalancette ) [449945]
- [xen] save phys addr for crash utility (Bill Burns ) [443618]
- [xen] kexec: allocate correct memory reservation (Bill Burns ) [442661]- [gfs2] glock dumping missing out some glocks (Steven Whitehouse ) [456334]
- [scsi] ibmvscsi: add tape device support (Brad Peters ) [439488]
- [misc] irq: reset stats when installing new handler (Eugene Teo ) [456218]
- [scsi] ibmvscsi: latest 5.3 fixes and enhancements (Brad Peters ) [439487]
- [selinux] prevent illegal selinux options when mounting (Eugene Teo ) [456052]
- [xen] remove blktap sysfs entries before shutdown (Chris Lalancette ) [250104]
- [xen] don't collide symbols with blktap (Chris Lalancette ) [250104]
- [xen] blktap: modify sysfs entries to match blkback (Chris Lalancette ) [250104]
- [xen] don't try to recreate sysfs entries (Chris Lalancette ) [250104]
- [xen] blktap: stats error cleanup (Chris Lalancette ) [250104]
- [xen] blktap: add statistics (Chris Lalancette ) [250104]
- [xen] rename blktap kernel threads to blktap.dom.blkname (Chris Lalancette ) [250104]
- [ia64] xen: incompatibility with HV and userspace tools (Tetsu Yamamoto ) [444589]
- [usb] add ids for WWAN cards (John Feeney ) [253137]
- [ia64] handle invalid ACPI SLIT table (Luming Yu ) [451591]
- [pci] mmconfig: use conf1 for access below 256 bytes (Tony Camuso ) [441615 251493]
- [pci] mmconfig: rm pci_legacy_ops and nommconf blacklist (Tony Camuso ) [441615 251493]
- [pci] mmconfig: remove pci_bios_fix_bus_scan_quirk (Tony Camuso ) [441615 251493]
- [fs] nlm: tear down RPC clients in nlm_shutdown_hosts (Jeff Layton ) [254195]
- [fs] nlm: don't reattempt GRANT_MSG with an inflight RPC (Jeff Layton ) [254195]
- [fs] nlm: canceled inflight GRANT_MSG shouldn't requeue (Jeff Layton ) [254195]
- [fs] potential race in mark_buffer_dirty (Mikulas Patocka ) [442577]- [fs] lockd: nlmsvc_lookup_hokD\@\[DW?Vd		K48PT]d	k(@(	(
((	H(
	(
0(
((
(
8
y9y:$yFJ9GJ\(HJ(IK(XLYL\L(]L(^N#bRxdSeSfS#kS%lS*tS@(uS(vTwU0(xU(yVp{V(VVVAW)A
WjWW(WgWhWCpopt1.10.2.336.el5_11A C library for parsing command line parameters.Popt is a C library for parsing command line parameters. Popt was
heavily influenced by the getopt() and getopt_long() functions, but it
improves on them by allowing more powerful argument expansion. Popt
can parse arbitrary argv[] style arrays and automatically set
variables based on command line arguments. Popt allows command line
arguments to be aliased via configuration files and includes utility
functions for parsing arbitrary strings into argv[] arrays using
shell-like rules.TVbuilder17.centos.org
CentOS-5CentOSGPLv2+Development/Librarieshttp://www.rpm.org/linuxi386?vqp!V%VnNnn{nnnBennKXn(A큤TVpTVTVpTVpTVTVGGGTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVoTVpTVpTVpTVpTVpTVpTVpTVpTVpTVpTVpTVpTVpTVp145e0319efcb2f3488305fef728becbae27d1d5b57aab3569235ac1fdc4fbe0f5cced841bbb3091c74fce5ec5981b2c4b0decc5bf25455b28ca165ddbba5c5aacb0613c30af2a8249b8dcc67d3edb06dc4ad925504790aa55b609bb88864947bad30660d5307d290356f7cf317525ad97942b69bbf87ec801116bef26195965c3f457a3031f2e10c0f7b43aa24af03f8c5805d672a21ae1ffc059a35e09302673f457a3031f2e10c0f7b43aa24af03f83f457a3031f2e10c0f7b43aa24af03f8e7c755382f305d2d2a0209f7957f5ed61f9bb9d26aac968969169575e903347fc4422ae2e325021a27515cedf231938b3f457a3031f2e10c0f7b43aa24af03f8dcfb54bb80ca87fce1df3a2de197c4773f457a3031f2e10c0f7b43aa24af03f83f457a3031f2e10c0f7b43aa24af03f8cb19be6f68ef1824c578f7d1de2b9c0fe7e8e31a150938c79704aa09851cf4a9c2d4f5ebf46b044ca8815615cab6090f036fd9e282e2890b31a9fa273b656a803f457a3031f2e10c0f7b43aa24af03f85cacb17b88b0e5440ceb7007da437956263fed49e3482847dee9165abd3c11968b1740dcfc578fb5acfc3e0ab83b92ebc5bc05b4fc6a61ae4507325f5599a35f3f457a3031f2e10c0f7b43aa24af03f84169a7c1d9d7cee90d763cd435f1fb134107733f83e3d1420def5dcc4003351f0a69c776e53cece98664c7133ab0e100ddd8b3e980e44b5bbaff4b2821111d563f457a3031f2e10c0f7b43aa24af03f825d32b1ba8c49133bcfb9098561de162358ba6b42ce71b1d881cfa2f0a486cda7ae2c961a62721b60a6e79d5daad9018libpopt.so.0.0.0libpopt.so.0.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootr$k@@################################################################################################$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&''()'*+',-'./'01'23'45'67'89':;'<=''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''>?'@A'BC'DE'FG'HI'JK''LMNO''PQRSTTTTUUUTTTTVVTTTWWWWWWWWWTTTXXXXYYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\j@eff Layton ) [448754]
- [gfs2] d_doio stuck in readv waiting for pagelock (Bob Peterson ) [432057]
- [fs] ext3: fix lock inversion in direct io (Josef Bacik ) [439194]
- [fs] jbd: fix journal overflow issues (Josef Bacik ) [439193]
- [fs] jbd: fix typo in recovery code (Josef Bacik ) [447742]
- [openib] small ipoib packet can cause an oops (Doug Ledford ) [445731]
- [sched] domain range turnable params for wakeup_idle (Kei Tokunaga ) [426971]
- [edac] k8_edac: fix typo in user visible message (Aristeu Rozanski ) [446068]
- [net] ipv6: don't handle default routes specially (Neil Horman ) [426895 243526]
- [fs] ext3: unmount hang when quota-enabled goes error-RO (Eric Sandeen ) [429054]
- [net] ipv6: no addrconf for bonding slaves (Andy Gospodarek ) [236750]
- [misc] fix race in switch_uid and user signal accounting (Vince Worthington ) [441762 440830]
- [misc] /proc/pid/limits : fix duplicate array entries (Neil Horman ) [443522]
- [nfs] v4: fix ref count and signal for callback thread (Jeff Layton ) [423521]
- [mm] do not limit locked memory when using RLIM_INFINITY (Larry Woodman ) [442426]
- [xen] ia64: add srlz instruction to asm (Aron Griffis ) [440261]
- [nfs] fix transposed deltas in nfs v3 (Jeff Layton ) [437544]
- [x86_64] gettimeofday fixes for HPET, PMTimer, TSC (Prarit Bhargava ) [250708]
- [ia64] remove assembler warnings on head.S (Luming Yu ) [438230]
- [misc] allow hugepage allocation to use most of memory (Larry Woodman ) [438889]
- [edac] k8_edac: add option to report GART errors (Aristeu Rozanski ) [390601]
- [ia64] add TIF_RESTORE_SIGMASK and pselect/ppoll syscall (Luming Yu ) [206806]-  [misc] signaling msgrvc() should not pass back error (Jiri Pirko ) [452533]
- [ia64] properly unregister legacy interrupts (Prarit Bhargava ) [445886]
- [s390] zfcp: status read locking race (Hans-Joachim Picht ) [451278]
- [s390] fix race with stack local wait_queue_head_t. (Hans-Joachim Picht ) [451279]
- [s390] cio: fix system hang with reserved DASD (Hans-Joachim Picht ) [451222]
- [s390] cio: fix unusable zfcp device after vary off/on (Hans-Joachim Picht ) [451223]
- [s390] cio: I/O error after cable pulls (Hans-Joachim Picht ) [451281]
- [s390] tape: race condition in tape block device driver (Hans-Joachim Picht ) [451277]
- [gfs2] cannot use fifo nodes (Steven Whitehouse ) [450276]
- [gfs2] bad subtraction in while-loop can cause panic (Bob Peterson ) [452004]
- [tux] crashes kernel under high load (Anton Arapov ) [448973]
- [dlm] move plock code from gfs2 (David Teigland ) [450138]
- [dlm] fix basts for granted CW waiting PR/CW (David Teigland ) [450137]
- [dlm] check for null in device_write (David Teigland ) [450136]
- [dlm] save master info after failed no-queue request (David Teigland ) [450135]
- [dlm] keep cached master rsbs during recovery (David Teigland ) [450133]
- [dlm] change error message to debug (David Teigland ) [450132]
- [dlm] fix possible use-after-free (David Teigland ) [450132]
- [dlm] limit dir lookup loop (David Teigland ) [450132]
- [dlm] reject normal unlock when lock waits on lookup (David Teigland ) [450132]
- [dlm] validate messages before processing (David Teigland ) [450132]
- [dlm] reject messages from non-members (David Teigland ) [450132]
- [dlm] call to confirm_master in receive_request_reply (David Teigland ) [450132]
- [dlm] recover locks waiting for overlap replies (David Teigland ) [450132]
- [dlm] clear ast_type when removing from astqueue (David Teigland ) [450132]
- [dlm] use fixed errno values in messages (David Teigland ) [450130]
- [dlm] swap bytes for rcom lock reply (David Teigland ) [450130]
- [dlm] align midcomms message buffer (David Teigland ) [450130]
- [dlm] use dlm prefix on alloc and free functions (David Teigland ) [450130]
- [s390] zfcp: memory handling for GID_PN (Hans-Joachim Picht ) [447727]
- [s390] zfcp: out-of-memory handling for status_read req (Hans-Joachim Picht ) [447726]
- [s390] zfcp: deadlock in slave_destroy handler (Hans-Joachim Picht ) [447329]
- [s390] dasd: fix timeout handling in interrupt handler (Hans-JoachimTjP@or suid/sgid processes (Frederic Weisbecker) [655194]
- [security] rlimits: implement prlimit64 syscall (Frederic Weisbecker) [655194]
- [security] rlimits: add rlimit64 structure (Frederic Weisbecker) [655194]
- [security] rlimits: switch more rlimit syscalls to do_prlimit (Frederic Weisbecker) [655194]
- [security] rlimits: redo do_setrlimit to more generic do_prlimit (Frederic Weisbecker) [655194]
- [security] rlimits: do security check under task_lock (Frederic Weisbecker) [655194]
- [security] rlimits: allow setrlimit to non-current tasks (Frederic Weisbecker) [655194]
- [security] rlimits: split sys_setrlimit (Frederic Weisbecker) [655194]
- [security] rlimits: ensure rlim_max never grows in sys_setrlimit (Frederic Weisbecker) [655194]
- [security] rlimits: add task_struct to setrlimit (Frederic Weisbecker) [655194]
- [net] igbvf driver update (Stefan Assmann) [794926]
- [net] virtio: get/set UFO, get rx csum via ethtool (Jiri Benc) [748335]
- [char] ipmi: Increase KCS timeouts (Matthew Garrett) [605727]
- [pci] fix upstream P2P bridge checks when enabling OBFF and LTR (Myron Stowe) [834708]
- [net] igb driver update (Stefan Assmann) [794925]
- [virt] xen: add the CDROM_GET_CAPABILITY ioctl to blkfront (Laszlo Ersek) [604181]
- [virtio] pci: disallow entering suspend states (Amit Shah) [834511]
- [fs] ext4: Fix overflow caused by missing cast in ext4_fallocate (Lukas Czerner) [830351]
- [xen] Fix #GPF injection into compat guests in vm86 code (Igor Mammedov) [837032]
- [xen] x86: emulate lea with two register operands correctly (Igor Mammedov) [837032]- [net] be2net: Disable num_vfs param as SR-IOV not on RHEL5 (Ivan Vecera) [836876]
- [net] ixgbevf: Set jumbo frames correctly after PF reset (Andy Gospodarek) [794922]
- [net] ixgbevf: Add support to recognize 100mb link speed (Andy Gospodarek) [794922]
- [net] ixgbevf: Fix mailbox interrupt ack bug (Andy Gospodarek) [794922]
- [net] ixgbevf: Prev possible race cond by checking for message (Andy Gospodarek) [794922]
- [net] ixgbevf: Fix reg defines to handle complex expressions (Andy Gospodarek) [794922]
- [net] ixgbe: Fix case of Tx Hang in PF with 32 VFs (Andy Gospodarek) [794920]
- [net] ixgbe: Add param to allow untested and unsafe SFP+ modules (Andy Gospodarek) [794920]
- [net] ixgbe: add support for new 82599 device. (Andy Gospodarek) [794920]
- [net] ixgbe: add support for new 82599 device id (Andy Gospodarek) [794920]
- [net] ixgbe: Reconfigure SR-IOV Init (Andy Gospodarek) [794920]
- [net] e1000e: use more logging macros when netdev not registered (Dean Nelson) [794921]
- [net] e1000e: test for valid check_reset_block function pointer (Dean Nelson) [794921]
- [net] e1000e: fix Rapid Start Technology support for i217 (Dean Nelson) [794921]
- [net] e1000e: fix typo in def of E1000_CTRL_EXT_FORCE_SMBUS (Dean Nelson) [794921]
- [net] e1000e: Fix merge conflict (net->net-next) (Dean Nelson) [794921]
- [net] e1000e: increase version number (Dean Nelson) [794921]
- [net] e1000e: clear REQ and GNT in EECD (82571 && 82572) (Dean Nelson) [794921]
- [net] e1000e: enable forced master/slave on 82577 (Dean Nelson) [794921]
- [net] e1000e: initial support for i217 (Dean Nelson) [794921]
- [net] e1000e: Rem special case for 82573/82574 ASPM L1 disable (Dean Nelson) [794921]
- [net] e1000e: Disable ASPM L1 on 82574 (Dean Nelson) [794921]
- [net] e1000e: Driver workaround for IPv6 Hdr Extension Erratum. (Dean Nelson) [794921]
- [net] e1000e: Fix intermittent negotiation issue on 82574/82583. (Dean Nelson) [794921]
- [net] e1000e: cleanup [read|write]_reg_locked PHY ops funcptrs (Dean Nelson) [794921]
- [net] e1000e: suggest possible workaround to dev hang on 82577/8 (Dean Nelson) [794921]
- [net] e1000e: fix .ndo_set_rx_mode for 82579 (Dean Nelson) [794921]
- [net] e1000e: PHY initialization flow changes for 82577/8/9 (Dean Nelson) [794921]
- [net] e1000e: workaround EEPROM configuration change on 82579 (Dean Nelson) [794921]
- [net] e1000e: 82579 potential sys hang on stress when ME enabled (Dean Nelson) [794921]
- [net] e1000e: 82579 packet droph}8||keys@T  Bk` &@G?+d	0	A		
s
xT(89	@:2?BFGHIXYZ$[,\0]<^\b{defklt u,v8wxy{(<@PAA
ghCxorg-x11-server-Xnest1.1.148.107.el5.centosA nested server.Xnest is an X server, which has been implemented as an ordinary
X application.  It runs in a window just like other X applications,
but it is an X server itself in which you can run other software.  It
is a very useful tool for developers who wish to test their
applications without running them on their real X server.Tbuilder17.centos.org9@CentOS-5CentOSMIT/X11User Interface/Xhttp://www.x.orglinuxx86_649+T큤TTTa0ef68936ba4407021065d75baec51d1465441b29e70b84ceaa1685e343c765715b908ef06c2fc3fccc8db1ac1e21858rootrootrootrootrootrootxorg-x11-server-1.1.1-48.107.el5.centos.src.rpmXnestxorg-x11-server-Xnest@@@@@@@@@@@@@@@@@@JJ@libX11.so.6()(64bit)libXau.so.6()(64bit)libXdmcp.so.6()(64bit)libXext.so.6()(64bit)libXfont.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libfontenc.so.1()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpam_misc.so.0()(64bit)libpam_misc.so.0(LIBPAM_MISC_1.0)(64bit)libselinux.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)xorg-x11-fonts-base3.0.4-14.0-14.4.2.3TT`S1`RRW#`Q`P`P`P`PuP\`P\`PXPPO`ONG`N{NfNM`NM`NL9NL9M`Mm`Mw`L`LnK`K`K`KiK^`KKJgJgJI9`J&`J%Jf`J}`J`JBJ	`J	`IpIpI6`I`I=H
H`HfHɔHɔHZ`HZ`HeHeH?'`GG`G`GGG`G-GGrGrG!`GGG`GY`F&F``F`FF|F`FzFd`Fd`Fd`Fd`Fa`F`F`E`E`EwE}Ew=`Ew=`EuEpEnEnET`EKEIE>E$.E$.E$.E!E`EQ`E\EEE`E`DDD`D[D
`D
`Dg`DrDrD!`D~`D,D8`D8`D8`DDCD۬`DZD	`D׷D׷D׷D `DʈDʈDʈDDƔ`DƔ`DBDN`DN`DYD`DpDpDpD`D`D*D*D`DDD`DXDoDoD`D`D`D`D)D`DD5`D5`DDDD`DDL`DL`DD`Dv(DsDsDe`DVDMJ`D>D=x`D=x`D<&D82`D5`D2`D#`D!D w`DCC`CCiC`CCCu`Cκ`C!C`C`C}C`C`C`C|`CyCyCyCw`Cu`CsCrq`Co`CaMCAC@X`CCC`Johnny Hughes <johnny@centos.org> 1.1.1-48.107.el5.centosAdam Jackson <ajax@redhat.com> 1.1.1-48.107Adam Jackson <ajax@redhat.com> 1.1.1-48.104Soren Sandmann <ssp@redhat.com> 1.1.1-48.103Peter Hutterer <peter.hutterer@redhat.com> 1.1.1-48.101.1Adam Jackson <ajax@redhat.com> 1.1.1-48.101Adam Jackson <ajax@redhat.com> 1.1.1-48.100Adam Jackson <ajax@redhat.com> 1.1.1-48.99Adam Jackson <ajax@redhat.com> 1.1.1-48.98Adam Jackson <ajax@redhat.com> 1.1.1-48.97Dave Airlie <airlied@redhat.com> 1.1.1-48.96Adam Jackson <ajax@redhat.com> 1.1.1-48.95DaveXk@USURURURUSUSUSUSUSUSUTUSUSURUSUSUSUSUSUSUSURUSUSUSUSUSUSUSUSUSUSUSUSURURURUSUSUSUSUTUSUSUSUSURUSUSURUSUTUSUSURURUSUSURUSUSUSUSUSUSUSUSUSUSUSUSURUSUSUSURURURUSUSUSURUSUSUSUSUSUSUSUSUTUTUSUTUSUSUSUSURUSUSUSUTUSUSURUSUSURUSUSUSUSURURURUSURURUSUSURUSUSUSUSURUSUSUSURUSUSURUSURUSUSURURUSUSUSURUSUSUSUSUSUSUSURUSUSUSUSUSUSUSUSUSUSURURUSUSURURUSURURURUTUTUTUSUSUSUTUSUSUSUSUSUSUSUSUSUSURURUSUSUSUSUSUSUSUSURUSUSUSUSUSURUSUSURUSUSUSUSUSUSURUSURUSURURUSUSUSUSUSUSUSUSUSUSUSURUSUSUSURUSURUSUSUSURUSUSUSUSUSURUSUSUSURUTUSUSUTUSURUSUSUSUSUSUSUSUSUSUTUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUTURUSUTUSURUSUSUSUSUSURUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSURUTUTURUTURURURURURURUTUTUTUTUTUTUTURURUTUTUTUTUTURUTUTURUTUTURURUTURURURURURURURURURURURURURURURURURUTUTURUTURUTUTURURURURURURURURURURURURURURURURURURURUTUTUTUTURURURUTURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURURUR3f4eadea36cde90cb15e69e60d29b32fb47fde291a7ff0d6edc9151f3af2ce2d98c085da4fee043f2a715f5530fc1b5fdcf0a7daf3a3ca2df4c8f5b67686298cc0f422a7e88f3946800db8828cfa14c12617058a092497d98fc4ef54a7291704ea61df7da782ae900f18219735aa7e92c5c40974733e323d3d3fb5a1d4a5d46511eaa832f3e48035326513193efd0674d4b717ebaeb7265efee0d7b69108c5a8ed1cb626749f08fb3cdca870dbd56e64bbd569025874c6750bbfa0974a21d7c2c860d08d61ac919d1c85e687399cf2b4eaf248b97633eb4aea83ea535da60d42b73a890925b3a7e57f9614823f51f9571c62943889a715d7a2b4979d64142d6a9db336b2cd715f7b4e1dbf7d04fe66e55608c676829a78ba82228eed94e1aaef99b4b52d8a0862ebe4c00fe105de958d4ce7af50a9d2886c977b1c173fc6cf7561dd6e1059351da248adc0e0a97250cebd9f5a6549c90139a2c697a664391a4e51c92b25bf3555b289928e2d7b7150f85f2de414c947bbd8783e7920a0aad553fdd9d6537c9e8af4eb3cc5c431d442a04cf517826367f4ccaf1a5ea008a1f5e6260405cace1206ce467924b50ff391a08aac3468982ea959778706706d6705c2974d800147c8274d337d9293fdad300e506ebadcea2edf7091421f90b7c5d79a2dff5a1644e26f0e6965794aac3f7c0d6da60cbe29d908537d3bb76c1982b0aadba477975a3facabf514edc1e274343b593361e53dc503cb70df86525b274bbc265d1aabf074bfc2f52a17bd19166209b62de7b439691100c617d7c31888167146ad5b8c564993f29e441ac2721de0ed4196e28c380ef7042311b84bd06c682bd95c6512a7f26fafb6875501a878b95f90b09478afb2898a0df2604c3d307f81d4ab464b0223ce36c55cc4d785410989faae39ea26e706eb421703fb82af1f2e6debabb8e9af8918359deb883ddb4be33b92d30cffc81ea559cdd001935f227c645948102d32a86250a75b7d101a167d496dcf7d01bd6389ccaf289a45ea5698515c8123afd93dd8e872c4884e6f61f3b5ad4c8a416dfdbf29f24db367db4c1b323b8d59a8a35e35733150c137d3be549fe1e713ceb7caf41247d63a60a5530906d8db047cd7d31288b661869789950dc26fde7e521b072e9e86943dedda2ba19db4ff5e6126dc73e0d0e17f0862ffd7ebd0a13a960492318f7e9a733a3c0e558bba6815548e8867a9bb99a04d2c119d81a3d7b4a29558bdc62d2e1b2bcf3e2ceeceaa2c6b0247267966c71e6e6abca94a0c338be017497304d0a35a8ee5e03f2d98428d32104740ee0a5ed0057476779a95011fdabbc406f23fadb35a34bdb92fa01872b53fd95e15711c5549b4a66fb2186441910348fbdc6d24ee3027c612d988ac1f47b2cbdd1bb33cc32e2193824915cdf447888806e196baaf021a64f70f453cba2dd986b5a9f731209622e6c1Wk@\| >0DDHeq'%h}WcWFlXaB/$q_Y}K1}ext|v*
>!L(	c}
N	<%(ss^u/	/<t:;ay,
op2
fj^5fg2%.x!DGQfRI]84u$l0jk#FZ	8	Yolj*eS
x]+)A큤AAAAA큤AAA큤AUZUTUTUTUTUTUTUTURURUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZUZU[<ʽ@>C@O@TW@OAC?lS?UUzUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTUTURURUTUSUSUSUSUTURURURUSUSUSUSURUSUSUSUSUSUSURURUSUSUTUSUSUSUSURUSUSUSUSUSUSURUSUSUSUSUSURUSURURUSUSUSURUSUSUSURUSUTUSURURURURUSUSUSURURURUSUSUSURURURURURURUSUSUSUSUSUSUSUSUS:k=@d password, despite documentation
- Added the -warnings patch to quiet some compiler warnings.
- Removed many obsolete patches from CVS.- New upstream release.
- the -64bit-timestamps, -clitar, -establish_trust, user_rights_v1,
  winbind_find_dc_v2 patches are now obsolete.- New upstream release
- add my -quoting patch, to fix swat with strings that contain
  html meta-characters, and to use correct quote characters in
  lists, closing bz#134310
- include the upstream winbindd_2k3sp1 patch
- include the -smbclient patch.
- include the -hang patch from upstream.- add a "exit 0" to the postun of the main samba package- rebuild with openssl-0.9.7e- Use the updated filter-requires-samba.sh file, so we don't accidentally
  pick up a dependency on perl(Crypt::SmbHash)- add -gcc4 patch to compile with gcc 4.
- remove the now obsolete -smbclient-kerberos.patch
- Include four upstream patches from
  http://samba.org/~jerry/patches/post-3.0.11/
  (Slightly modified the winbind_find_dc_v2 patch to apply easily with
  rpmbuild).- include -smbspool patch to close bz#104136- Update the -man patch to fix ntlm_auth.1 too.
- Move pam_smbpass.so to the -common package, so both the 32
  and 64-bit versions will be installed on multiarch platforms.
  This closes bz#143617
- Added new -delim patch to fix mount.cifs so it can accept
  passwords with commas in them (via environment or credentials
  file) to close bz#144198- Rebuilt for new readline.- New upstream release that closes CAN-2004-1154  bz#142544
- Include the -64bit patch from Nalin.  This closes bz#142873
- Update the -logfiles patch to work with 3.0.10
- Create /var/run/winbindd and make it part of the -common rpm to close
  bz#142242- New upstream release.  This obsoletes the -secret patch.
  Include my changetrustpw patch to make "net ads changetrustpw" stop
  aborting.  This closes #134694
- Remove obsolete triggers for ancient samba versions.
- Move /var/log/samba to the -common rpm.  This closes #76628
- Remove the hack needed to get around the bad docs files in the
  3.0.8 tarball.
- Change the comment in winbind.init to point at the correct pidfile.
  This closes #76641- fix unresolved symbols in libsmbclient which caused applications
  such as KDE's konqueror to fail when accessing smb:// URLs. #139894- Rescue the install.mount.smbfs patch from Juanjo Villaplana
  (villapla@si.uji.es) to prevent building the srpm from trashing your
  installed /usr/bin/smbmount- Include the corrected docs tarball, and use it instead of the
  obsolete docs from the upstream 3.0.8 tarball.
- Update the logfiles patch to work with the updated docs.- New upstream version fixes CAN-2004-0930.  This obsoletes the
  disable-sendfile, salt, signing-shortkey and fqdn patches.
- Add my <fenlason@redhat.com> ugly non-ascii-domain patch.
- Updated the pie patch for 3.0.8.
- Updated the logfiles patch for 3.0.8.- New upstream version
- Add Nalin's signing-shortkey patch.- disable the -salt patch, because it causes undefined references in
  libsmbclient that prevent gnome-vfs from building.- Re-enable the x_fclose patch that was accidentally disabled
  in 3.0.8-0.pre1.1.  This closes #135832
- include Nalin's -fqdn and -salt patches.- Include disable-sendfile patch to default "use sendfile" to "no".
  This closes #132779- Include patch from Steven Lawrance (slawrance@yahoo.com) that modifies
  smbmnt to work with 32-bit uids.- new upstream release.  This obsoletes the ldapsam_compat patches.- Update docs section to not carryover the docs/manpages directory
  This moved many files from /usr/share/doc/samba-3.0.7/docs/* to
  /usr/share/doc/samba-3.0.7/*
- Modify spec file as suggested by Rex Dieter (rdieter@math.unl.edu)
  to correctly create libsmbclient.so.0 and to use /etc/rc.d/init.d instead
  of rolling our own.  This closes #132642
- Add patch to default "use sendfile" to no, since sendfile appears to
  be broken
- Add patch from Volker Lendecke <vl@samba.org> to help make
  ldapsam_compat work again.
- Add patch from "Vince Brimhall" <vbrimhall@novelkІ,@,,,ch for freshen on colored transactions (#813282)- Add DWARF 3 and 4 support to debugedit (#808547)
- No longer add \n to group tag in Python bindings (#783451)
- Fix typos in Japanese rpm man page (#760552)
- Bump Geode compatibility up to i686 (#620570)- Proper region tag validation on package/header read (CVE-2012-0060)
- Double-check region size against header size (CVE-2012-0061)
- Validate negated offsets too in headerVerifyInfo() (CVE-2012-0815)- Revert fix for #740291, too many packages rely on the broken behavior- Add support for XZ-compressed sources and patches to rpmbuild (#620674)
- Avoid unnecessary assert-death when closing NULL fd (#573043)
- Add scriptlet error notification callbacks (#533831)- Honor --noscripts for pre- and posttrans scriptlets too (#740345)
- Avoid bogus error on printing empty ds from python (#628883)
- File conflicts correctness & consistency fixes (#740291)
- Create the directory used for transaction lock if necessary (#510469)
- Only enforce default umask during transaction (#673821)- fix thinko in the CVE backport- fix CVE-2011-3378 (#742157)- accept windows cr/lf line endings in gpg keys (#530212)- Backport multilib ordering fixes from rpm 4.8.x (#641892)- make the sbits removal behavior consistent with all the RHELs- fix CVE-2010-2059, fails to drop SUID/SGID bits on package upgrade (#626708)
- fix SELinux memory leak (#566746), patch from Florian Festi- Really fix #511354- Treat em64t architecture as an alias for x86_64 (#511354)- Disable dependency caching chroot'ed verify (#508074)- pad RSA signatures to modulus size if necessary (#502791)- small fix to Japanese translation (#387321)- backport default patch fuzz feature from upstream (#471005)
Resolves: #471005- fix pgp fingerprint calculation (#493777)
- performance tweaks (#435475)
  - better hash algorithm to speed up initial install
  - avoid crazy memory fragmentation on file fingerprinting
  - eliminate unnecessary allocations from rpmdsCompare() hotpath- dont abort build if debugedit fails (#482903)- Filter out timestamp differences of shared files on verify (#472151)
- Perform verification in real chroot if --root specified (#434150)
- Check for arch compatibility on colored transactions too (#472065)- Remove RDTSC timer code causing floating point exceptions on xen (#472467)- Restore default SIGPIPE for scriptlets and --pipe (#471591)- Fix exit code on file not found errors (#463944, #446202)
- Always honor epoch (no)promote behavior in dependency sets (#466503)- Abort transaction on traceback in python callback (#463999)- Disallow creation of packages larger than we can cleanly handle (#448488)
- Fix retrieval of multiple packages through proxy (#450205)- Temporarily permit conflicts in /usr/share/doc/ (#460808)
- Fix --dump usage description in Japanese manual too (#250207)- rpm-libs requires popt, add corresponding Requires:
- Related: #454887- Close all file descriptors before running scriptlets (#453645)
- Tighten up dependencies between sub-packages- Rebase to RPM 4.4.2.3 from F9 (#454887)
- Much cleaned up spec
- NSS used instead of beecrypt for lowlevel crypto (#444805)
- Provides no longer treated as implicit obsoletes (#233713, #348971)
- Use root:root for file ownerships everywhere (#439417)
- Improved .rpmsave/.rpmnew behavior (#426258)
- Exit code corrections (#244236, #440595)
- Improved multilib build support (#257921)
- Improved debuginfo extraction (#251333)
- Dozens of other issues resolved- Don't show errors twice on non-existent files (#215712)
- Update scriptlet names to match what's available (#248128)- disable ldconfig optimizations (#253492)- Rebuild due to apparent builroot temporary hickup to really fix #211119- Create x86_64 compat macros for ia32e and amd64 (#211119)- Fix typo in script- Group multilb packages patch from jbj (#220348,#225074,#225077)- actually apply the multiple installs patch (#213399)- permit multiple versions of a package to be installed within a transaction
  with -i (#213399)- Update replaced state in tran
$HF/var/lib/rpm/PackagesB40 Fu1u1HH!H! Ekr;	Pk
(kplckGX#?k i_il@'ibxi)i[fBj@0j"h#%ko@p$k89#k!Pо"ky k~@kxk ~jj@j8CHKj\ojij[jlh'j@\p6j(j` jخ$j}`0jHkH(8k8(
k"{klI lQQl~P0hkIlGZjI
lzk8HpkC`9jh'k`k8kp]]kZxklкPkpx9kk<	q0k=Hvkx@TjbxHkoLRj;	Hkp`Pjp+Oj Njo((
MjPjjXؼkpsk`qk8k kJ kJp~p;7kx6kPV`9j*4k`0g7jXSk "Rk8	XC8Qk8	PppPkp8wkvk(l:	FpMk9	8\Lk;	ikqfghk9	)9j_xuDj
j8&(Bj8	PPHAjmx	xti6	ph5	6vik0gh7	ljG gjukPZ'kzjY
	k
6Xj;	 k:	Xx&j;	ЈPkpEFjIk8k9	pekOHk9	p,jk &&
jrk(k1k0k(Pw.l!09	3%5!.l

Anon7 - 2021